Matches in SemOpenAlex for { <https://semopenalex.org/work/W1485408222> ?p ?o ?g. }
- W1485408222 endingPage "1784" @default.
- W1485408222 startingPage "1778" @default.
- W1485408222 abstract "Cupiennin 1a (GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME‐NH 2 ) is a potent venom component of the spider Cupiennius salei. Cupiennin 1a shows multifaceted activity. In addition to known antimicrobial and cytolytic properties, cupiennin 1a inhibits the formation of nitric oxide by neuronal nitric oxide synthase at an IC 50 concentration of 1.3 ± 0.3 µ m . This is the first report of neuronal nitric oxide synthase inhibition by a component of a spider venom. The mechanism by which cupiennin 1a inhibits neuronal nitric oxide synthase involves complexation with the regulatory protein calcium calmodulin. This is demonstrated by chemical shift changes that occur in the heteronuclear single quantum coherence spectrum of 15 N‐labelled calcium calmodulin upon addition of cupiennin 1a. The NMR data indicate strong binding within a complex of 1 : 1 stoichiometry." @default.
- W1485408222 created "2016-06-24" @default.
- W1485408222 creator A5000358550 @default.
- W1485408222 creator A5016259898 @default.
- W1485408222 creator A5030864773 @default.
- W1485408222 creator A5049191506 @default.
- W1485408222 creator A5066127571 @default.
- W1485408222 creator A5070655025 @default.
- W1485408222 creator A5083575636 @default.
- W1485408222 date "2007-02-22" @default.
- W1485408222 modified "2023-10-18" @default.
- W1485408222 title "Cupiennin 1a, an antimicrobial peptide from the venom of the neotropical wandering spider Cupiennius salei, also inhibits the formation of nitric oxide by neuronal nitric oxide synthase" @default.
- W1485408222 cites W1508375439 @default.
- W1485408222 cites W1628547227 @default.
- W1485408222 cites W1966899949 @default.
- W1485408222 cites W1975011768 @default.
- W1485408222 cites W1978217041 @default.
- W1485408222 cites W1979180704 @default.
- W1485408222 cites W1982846194 @default.
- W1485408222 cites W1987159249 @default.
- W1485408222 cites W1997782989 @default.
- W1485408222 cites W2001535102 @default.
- W1485408222 cites W2010711283 @default.
- W1485408222 cites W2024142216 @default.
- W1485408222 cites W2030490793 @default.
- W1485408222 cites W2031162718 @default.
- W1485408222 cites W2033851989 @default.
- W1485408222 cites W2037190307 @default.
- W1485408222 cites W2044970538 @default.
- W1485408222 cites W2050526040 @default.
- W1485408222 cites W2052366943 @default.
- W1485408222 cites W2069526662 @default.
- W1485408222 cites W2080676603 @default.
- W1485408222 cites W2081357320 @default.
- W1485408222 cites W2084344997 @default.
- W1485408222 cites W2119889081 @default.
- W1485408222 cites W2129601724 @default.
- W1485408222 cites W2135783131 @default.
- W1485408222 cites W2156069524 @default.
- W1485408222 cites W2169821755 @default.
- W1485408222 cites W2181409396 @default.
- W1485408222 cites W2397079773 @default.
- W1485408222 cites W2496679266 @default.
- W1485408222 cites W2950369001 @default.
- W1485408222 cites W4211204946 @default.
- W1485408222 cites W55483475 @default.
- W1485408222 doi "https://doi.org/10.1111/j.1742-4658.2007.05726.x" @default.
- W1485408222 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/17313650" @default.
- W1485408222 hasPublicationYear "2007" @default.
- W1485408222 type Work @default.
- W1485408222 sameAs 1485408222 @default.
- W1485408222 citedByCount "24" @default.
- W1485408222 countsByYear W14854082222012 @default.
- W1485408222 countsByYear W14854082222015 @default.
- W1485408222 countsByYear W14854082222016 @default.
- W1485408222 countsByYear W14854082222018 @default.
- W1485408222 countsByYear W14854082222019 @default.
- W1485408222 countsByYear W14854082222022 @default.
- W1485408222 countsByYear W14854082222023 @default.
- W1485408222 crossrefType "journal-article" @default.
- W1485408222 hasAuthorship W1485408222A5000358550 @default.
- W1485408222 hasAuthorship W1485408222A5016259898 @default.
- W1485408222 hasAuthorship W1485408222A5030864773 @default.
- W1485408222 hasAuthorship W1485408222A5049191506 @default.
- W1485408222 hasAuthorship W1485408222A5066127571 @default.
- W1485408222 hasAuthorship W1485408222A5070655025 @default.
- W1485408222 hasAuthorship W1485408222A5083575636 @default.
- W1485408222 hasConcept C12554922 @default.
- W1485408222 hasConcept C178790620 @default.
- W1485408222 hasConcept C181199279 @default.
- W1485408222 hasConcept C185592680 @default.
- W1485408222 hasConcept C2777622882 @default.
- W1485408222 hasConcept C2779281246 @default.
- W1485408222 hasConcept C29688787 @default.
- W1485408222 hasConcept C519581460 @default.
- W1485408222 hasConcept C55493867 @default.
- W1485408222 hasConcept C86803240 @default.
- W1485408222 hasConceptScore W1485408222C12554922 @default.
- W1485408222 hasConceptScore W1485408222C178790620 @default.
- W1485408222 hasConceptScore W1485408222C181199279 @default.
- W1485408222 hasConceptScore W1485408222C185592680 @default.
- W1485408222 hasConceptScore W1485408222C2777622882 @default.
- W1485408222 hasConceptScore W1485408222C2779281246 @default.
- W1485408222 hasConceptScore W1485408222C29688787 @default.
- W1485408222 hasConceptScore W1485408222C519581460 @default.
- W1485408222 hasConceptScore W1485408222C55493867 @default.
- W1485408222 hasConceptScore W1485408222C86803240 @default.
- W1485408222 hasIssue "7" @default.
- W1485408222 hasLocation W14854082221 @default.
- W1485408222 hasLocation W14854082222 @default.
- W1485408222 hasOpenAccess W1485408222 @default.
- W1485408222 hasPrimaryLocation W14854082221 @default.
- W1485408222 hasRelatedWork W1973054716 @default.
- W1485408222 hasRelatedWork W1998792901 @default.
- W1485408222 hasRelatedWork W2002027447 @default.
- W1485408222 hasRelatedWork W2028156322 @default.
- W1485408222 hasRelatedWork W2050559178 @default.
- W1485408222 hasRelatedWork W2098776639 @default.