FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W1531504703> ?p ?o ?g. }

• W1531504703 endingPage "9799" @default.
• W1531504703 startingPage "9793" @default.
• W1531504703 abstract "The complete amino acid sequence of the 86-residue heme subunit of flavocytochrome c (sulfide dehydrogenase) from the green phototrophic bacterium Chlorobium thiosulfatophilum strain Tassajara has been determined as follows: APEQSKSIPRGEILSLSCAGCHGTDGKSESIIPTIYGRSAEYIESALLDFKSGA- RPSTVMGRHAKGYSDEEIHQIAEYFGSLSTMNN. The subunit has a single heme-binding site near the N terminus, consisting of a pair of cysteine residues at positions 18 and 21. The out-of-plane ligands are apparently contributed by histidine 22 and methionine 60. The molecular weight including heme is 10,014. The heme subunit is apparently homologous to small cytochromes c by virtue of the location of the heme-binding site and its extraplanar ligands. However, the amino acid sequence is closer to Paracoccus sp. cytochrome c554(548) (37%) than it is to the heme subunit from Pseudomonas putida p-cresol methylhydroxylase flavocytochrome c (20%). The flavocytochrome c heme subunit is only 14% similar to the small cytochrome c555 also found in Chlorobium. Secondary structure predictions suggest N- and C-terminal helices as expected, but the midsection of the protein probably folds somewhat differently from the small cytochromes of known three-dimensional structure such as Pseudomonas cytochrome c551. Analyses of the residues near the exposed heme edges of the cytochrome subunits of P. putida and C. thiosulfatophilum flavocytochromes c (assuming homology to proteins of known structure) indicate that charged residues are not conserved, suggesting that electrostatic interactions are not involved in the association of the heme and flavin subunits. The N-terminal sequence of the flavoprotein subunit of flavocytochrome has also been determined. It shows no similarity to the comparable region of the p-cresol methylhydroxylase flavoprotein subunit from P. putida. The flavin-binding hexapeptide, isolated and sequenced earlier (Kenney, W. C., McIntire, W., and Yamanaka, T. (1977) Biochim. Biophys. Acta 483, 467-474), is situated at positions 40-46." @default.
• W1531504703 created "2016-06-24" @default.
• W1531504703 creator A5005253617 @default.
• W1531504703 creator A5011719285 @default.
• W1531504703 creator A5026427081 @default.
• W1531504703 creator A5042730297 @default.
• W1531504703 creator A5085664852 @default.
• W1531504703 date "1990-06-01" @default.
• W1531504703 modified "2023-10-16" @default.
• W1531504703 title "Complete amino acid sequence of the cytochrome subunit and amino-terminal sequence of the flavin subunit of flavocytochrome c (sulfide dehydrogenase) from Chlorobium thiosulfatophilum." @default.
• W1531504703 cites W114374583 @default.
• W1531504703 cites W1503157156 @default.
• W1531504703 cites W1770921839 @default.
• W1531504703 cites W1932052686 @default.
• W1531504703 cites W1969345643 @default.
• W1531504703 cites W1975304761 @default.
• W1531504703 cites W2001952299 @default.
• W1531504703 cites W2018765431 @default.
• W1531504703 cites W2022209638 @default.
• W1531504703 cites W2033662678 @default.
• W1531504703 cites W2053427143 @default.
• W1531504703 cites W2103584456 @default.
• W1531504703 cites W2113793273 @default.
• W1531504703 cites W2137816272 @default.
• W1531504703 cites W2408940446 @default.
• W1531504703 cites W259723296 @default.
• W1531504703 doi "https://doi.org/10.1016/s0021-9258(19)38741-1" @default.
• W1531504703 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/2161842" @default.
• W1531504703 hasPublicationYear "1990" @default.
• W1531504703 type Work @default.
• W1531504703 sameAs 1531504703 @default.
• W1531504703 citedByCount "13" @default.
• W1531504703 crossrefType "journal-article" @default.
• W1531504703 hasAuthorship W1531504703A5005253617 @default.
• W1531504703 hasAuthorship W1531504703A5011719285 @default.
• W1531504703 hasAuthorship W1531504703A5026427081 @default.
• W1531504703 hasAuthorship W1531504703A5042730297 @default.
• W1531504703 hasAuthorship W1531504703A5085664852 @default.
• W1531504703 hasBestOaLocation W15315047031 @default.
• W1531504703 hasConcept C104292427 @default.
• W1531504703 hasConcept C104317684 @default.
• W1531504703 hasConcept C167625842 @default.
• W1531504703 hasConcept C181199279 @default.
• W1531504703 hasConcept C185592680 @default.
• W1531504703 hasConcept C2778112365 @default.
• W1531504703 hasConcept C33093398 @default.
• W1531504703 hasConcept C55493867 @default.
• W1531504703 hasConcept C71240020 @default.
• W1531504703 hasConcept C86803240 @default.
• W1531504703 hasConceptScore W1531504703C104292427 @default.
• W1531504703 hasConceptScore W1531504703C104317684 @default.
• W1531504703 hasConceptScore W1531504703C167625842 @default.
• W1531504703 hasConceptScore W1531504703C181199279 @default.
• W1531504703 hasConceptScore W1531504703C185592680 @default.
• W1531504703 hasConceptScore W1531504703C2778112365 @default.
• W1531504703 hasConceptScore W1531504703C33093398 @default.
• W1531504703 hasConceptScore W1531504703C55493867 @default.
• W1531504703 hasConceptScore W1531504703C71240020 @default.
• W1531504703 hasConceptScore W1531504703C86803240 @default.
• W1531504703 hasIssue "17" @default.
• W1531504703 hasLocation W15315047031 @default.
• W1531504703 hasOpenAccess W1531504703 @default.
• W1531504703 hasPrimaryLocation W15315047031 @default.
• W1531504703 hasRelatedWork W1521845400 @default.
• W1531504703 hasRelatedWork W1863517480 @default.
• W1531504703 hasRelatedWork W1970974546 @default.
• W1531504703 hasRelatedWork W1985902348 @default.
• W1531504703 hasRelatedWork W1989493465 @default.
• W1531504703 hasRelatedWork W1996140555 @default.
• W1531504703 hasRelatedWork W2088565761 @default.
• W1531504703 hasRelatedWork W2090916946 @default.
• W1531504703 hasRelatedWork W2147240433 @default.
• W1531504703 hasRelatedWork W2160789234 @default.
• W1531504703 hasVolume "265" @default.
• W1531504703 isParatext "false" @default.
• W1531504703 isRetracted "false" @default.
• W1531504703 magId "1531504703" @default.
• W1531504703 workType "article" @default.