FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W1544609822> ?p ?o ?g. }

• W1544609822 endingPage "29211" @default.
• W1544609822 startingPage "29206" @default.
• W1544609822 abstract "IP4BP/Synaptotagmin II is an inositol-1,3,4,5-tetrakisphosphate (IP4) or inositol polyphosphate-binding protein, which is accumulated at nerve terminals. Here we report a novel function of the C2B domain, which was originally thought to be responsible for Ca(2+)-dependent binding to phospholipid membranes. A study of deletion mutants showed that about 30 amino acids of the central region of the C2B domain of mouse IP4BP/synaptotagmin II (315 IHLMQNGKRLKKKKTTVKKKTLNPYFNESFSF 346) are essential for inositol polyphosphate binding. This binding domain includes a sequence corresponding to the squid Pep20 peptide, which is also known to be essential for neurotransmitter release (Bommert, K., Charlton, M. P., DeBello, W. M., Chin, G. J., Betz, H., and Augustine, G. J. (1993) Nature 363, 163-165), suggesting that inositol polyphosphate has some effect on neurotransmitter release. Rabphilin 3A, another neuronal protein containing C2 domains, cannot bind IP4, indicating that the IP4 binding property is specific to the C2B domain of synaptotagmin. Phospholipid and IP4 binding experiments clearly indicated that the C2A and C2B domains have different functions. The C2A domain binds phospholipid in a Ca(2+)-dependent manner, but the C2B domain binds inositol polyphosphate and phospholipid irrespective of the presence of Ca2+. Our data suggest that the C2B domain of synaptotogamin is the inositol polyphosphate sensor at the synaptic vesicle and may be involved in synaptic function." @default.
• W1544609822 created "2016-06-24" @default.
• W1544609822 creator A5006116338 @default.
• W1544609822 creator A5033082809 @default.
• W1544609822 creator A5035555934 @default.
• W1544609822 creator A5048463873 @default.
• W1544609822 creator A5069629232 @default.
• W1544609822 date "1994-11-01" @default.
• W1544609822 modified "2023-09-29" @default.
• W1544609822 title "Inositol-1,3,4,5-tetrakisphosphate binding to C2B domain of IP4BP/synaptotagmin II." @default.
• W1544609822 cites W1486183250 @default.
• W1544609822 cites W1512666490 @default.
• W1544609822 cites W1525752116 @default.
• W1544609822 cites W1568294354 @default.
• W1544609822 cites W1591133722 @default.
• W1544609822 cites W1603561844 @default.
• W1544609822 cites W1964377967 @default.
• W1544609822 cites W1967817609 @default.
• W1544609822 cites W1976283234 @default.
• W1544609822 cites W1976753808 @default.
• W1544609822 cites W1978274366 @default.
• W1544609822 cites W1999127249 @default.
• W1544609822 cites W2000819264 @default.
• W1544609822 cites W2009105413 @default.
• W1544609822 cites W2010246058 @default.
• W1544609822 cites W2015358516 @default.
• W1544609822 cites W2021175997 @default.
• W1544609822 cites W2021788635 @default.
• W1544609822 cites W2026478305 @default.
• W1544609822 cites W2029386850 @default.
• W1544609822 cites W2051958752 @default.
• W1544609822 cites W2056293200 @default.
• W1544609822 cites W2060802834 @default.
• W1544609822 cites W2066953895 @default.
• W1544609822 cites W2068446924 @default.
• W1544609822 cites W2080324921 @default.
• W1544609822 cites W2089827948 @default.
• W1544609822 cites W2114640601 @default.
• W1544609822 cites W2160505936 @default.
• W1544609822 cites W2164220708 @default.
• W1544609822 cites W2187930412 @default.
• W1544609822 cites W2242835881 @default.
• W1544609822 cites W2413207117 @default.
• W1544609822 cites W4294216491 @default.
• W1544609822 cites W49357900 @default.
• W1544609822 doi "https://doi.org/10.1016/s0021-9258(19)62031-4" @default.
• W1544609822 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/7961887" @default.
• W1544609822 hasPublicationYear "1994" @default.
• W1544609822 type Work @default.
• W1544609822 sameAs 1544609822 @default.
• W1544609822 citedByCount "234" @default.
• W1544609822 countsByYear W15446098222012 @default.
• W1544609822 countsByYear W15446098222013 @default.
• W1544609822 countsByYear W15446098222014 @default.
• W1544609822 countsByYear W15446098222015 @default.
• W1544609822 countsByYear W15446098222016 @default.
• W1544609822 countsByYear W15446098222018 @default.
• W1544609822 countsByYear W15446098222019 @default.
• W1544609822 countsByYear W15446098222020 @default.
• W1544609822 countsByYear W15446098222021 @default.
• W1544609822 countsByYear W15446098222022 @default.
• W1544609822 crossrefType "journal-article" @default.
• W1544609822 hasAuthorship W1544609822A5006116338 @default.
• W1544609822 hasAuthorship W1544609822A5033082809 @default.
• W1544609822 hasAuthorship W1544609822A5035555934 @default.
• W1544609822 hasAuthorship W1544609822A5048463873 @default.
• W1544609822 hasAuthorship W1544609822A5069629232 @default.
• W1544609822 hasBestOaLocation W15446098221 @default.
• W1544609822 hasConcept C12554922 @default.
• W1544609822 hasConcept C130316041 @default.
• W1544609822 hasConcept C134306372 @default.
• W1544609822 hasConcept C148785051 @default.
• W1544609822 hasConcept C170493617 @default.
• W1544609822 hasConcept C185592680 @default.
• W1544609822 hasConcept C2777427919 @default.
• W1544609822 hasConcept C33923547 @default.
• W1544609822 hasConcept C36503486 @default.
• W1544609822 hasConcept C41625074 @default.
• W1544609822 hasConcept C55493867 @default.
• W1544609822 hasConcept C86473631 @default.
• W1544609822 hasConcept C86803240 @default.
• W1544609822 hasConceptScore W1544609822C12554922 @default.
• W1544609822 hasConceptScore W1544609822C130316041 @default.
• W1544609822 hasConceptScore W1544609822C134306372 @default.
• W1544609822 hasConceptScore W1544609822C148785051 @default.
• W1544609822 hasConceptScore W1544609822C170493617 @default.
• W1544609822 hasConceptScore W1544609822C185592680 @default.
• W1544609822 hasConceptScore W1544609822C2777427919 @default.
• W1544609822 hasConceptScore W1544609822C33923547 @default.
• W1544609822 hasConceptScore W1544609822C36503486 @default.
• W1544609822 hasConceptScore W1544609822C41625074 @default.
• W1544609822 hasConceptScore W1544609822C55493867 @default.
• W1544609822 hasConceptScore W1544609822C86473631 @default.
• W1544609822 hasConceptScore W1544609822C86803240 @default.
• W1544609822 hasIssue "46" @default.
• W1544609822 hasLocation W15446098221 @default.
• W1544609822 hasOpenAccess W1544609822 @default.
• W1544609822 hasPrimaryLocation W15446098221 @default.

• next