Matches in SemOpenAlex for { <https://semopenalex.org/work/W1673643417> ?p ?o ?g. }
Showing items 1 to 95 of
95
with 100 items per page.
- W1673643417 endingPage "3914" @default.
- W1673643417 startingPage "3910" @default.
- W1673643417 abstract "Both glucagon and the structurally similar glucagon-like peptide proteolytically derived from preproglucagon were purified from the endocrine pancreas of the channel catfish (Ictalurus punctata). This study represents the first report of the isolation of glucagon-like peptide from any source. Peptide sequences of glucagon-like peptide from other species have only been deduced from the cDNA sequences for preproglucagon. The sequence of the 34-residue glucagon-like peptide was found to be HADGTYTSDVSSYLQDQAAKDFITWLKSGQPKPE. Catfish glucagon-like peptide shares sequence identity at 26 of 31 residues with the putative glucagon-like peptide from anglerfish preproglucagon II. The mass of catfish glucagon-like peptide was found by fast atom bombardment-mass spectrometry to be 3785, identical with the value predicted by sequence analysis. This suggests that no post-translational modification occurs beyond proteolytic processing. The sequence of catfish glucagon was determined to be HSEGTFSNDYSKYLETRRAQDFVQWLM(N,S). Catfish glucagon exhibits a high degree of immunologic similarity with porcine glucagon by radioimmunoassay, whereas catfish glucagon-like peptide does not." @default.
- W1673643417 created "2016-06-24" @default.
- W1673643417 creator A5023506856 @default.
- W1673643417 creator A5065505340 @default.
- W1673643417 date "1985-04-01" @default.
- W1673643417 modified "2023-10-14" @default.
- W1673643417 title "Isolation and structures of glucagon and glucagon-like peptide from catfish pancreas." @default.
- W1673643417 cites W1505055776 @default.
- W1673643417 cites W1537014667 @default.
- W1673643417 cites W1576237099 @default.
- W1673643417 cites W1591608900 @default.
- W1673643417 cites W1602097684 @default.
- W1673643417 cites W1604529340 @default.
- W1673643417 cites W161721320 @default.
- W1673643417 cites W1978943973 @default.
- W1673643417 cites W1979613556 @default.
- W1673643417 cites W2003141714 @default.
- W1673643417 cites W2003550444 @default.
- W1673643417 cites W2005292801 @default.
- W1673643417 cites W2016291348 @default.
- W1673643417 cites W2024764743 @default.
- W1673643417 cites W2028944982 @default.
- W1673643417 cites W2032350393 @default.
- W1673643417 cites W2036106263 @default.
- W1673643417 cites W2061274996 @default.
- W1673643417 cites W2061393168 @default.
- W1673643417 cites W2084615192 @default.
- W1673643417 cites W2093070695 @default.
- W1673643417 cites W2137302959 @default.
- W1673643417 doi "https://doi.org/10.1016/s0021-9258(18)89208-0" @default.
- W1673643417 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/3838546" @default.
- W1673643417 hasPublicationYear "1985" @default.
- W1673643417 type Work @default.
- W1673643417 sameAs 1673643417 @default.
- W1673643417 citedByCount "74" @default.
- W1673643417 countsByYear W16736434172018 @default.
- W1673643417 crossrefType "journal-article" @default.
- W1673643417 hasAuthorship W1673643417A5023506856 @default.
- W1673643417 hasAuthorship W1673643417A5065505340 @default.
- W1673643417 hasBestOaLocation W16736434171 @default.
- W1673643417 hasConcept C126322002 @default.
- W1673643417 hasConcept C134018914 @default.
- W1673643417 hasConcept C185592680 @default.
- W1673643417 hasConcept C2775941552 @default.
- W1673643417 hasConcept C2776398474 @default.
- W1673643417 hasConcept C2777180221 @default.
- W1673643417 hasConcept C2778189562 @default.
- W1673643417 hasConcept C2778563252 @default.
- W1673643417 hasConcept C2778764654 @default.
- W1673643417 hasConcept C2909208804 @default.
- W1673643417 hasConcept C505870484 @default.
- W1673643417 hasConcept C55493867 @default.
- W1673643417 hasConcept C555293320 @default.
- W1673643417 hasConcept C71315377 @default.
- W1673643417 hasConcept C71924100 @default.
- W1673643417 hasConcept C86803240 @default.
- W1673643417 hasConcept C89423630 @default.
- W1673643417 hasConceptScore W1673643417C126322002 @default.
- W1673643417 hasConceptScore W1673643417C134018914 @default.
- W1673643417 hasConceptScore W1673643417C185592680 @default.
- W1673643417 hasConceptScore W1673643417C2775941552 @default.
- W1673643417 hasConceptScore W1673643417C2776398474 @default.
- W1673643417 hasConceptScore W1673643417C2777180221 @default.
- W1673643417 hasConceptScore W1673643417C2778189562 @default.
- W1673643417 hasConceptScore W1673643417C2778563252 @default.
- W1673643417 hasConceptScore W1673643417C2778764654 @default.
- W1673643417 hasConceptScore W1673643417C2909208804 @default.
- W1673643417 hasConceptScore W1673643417C505870484 @default.
- W1673643417 hasConceptScore W1673643417C55493867 @default.
- W1673643417 hasConceptScore W1673643417C555293320 @default.
- W1673643417 hasConceptScore W1673643417C71315377 @default.
- W1673643417 hasConceptScore W1673643417C71924100 @default.
- W1673643417 hasConceptScore W1673643417C86803240 @default.
- W1673643417 hasConceptScore W1673643417C89423630 @default.
- W1673643417 hasIssue "7" @default.
- W1673643417 hasLocation W16736434171 @default.
- W1673643417 hasOpenAccess W1673643417 @default.
- W1673643417 hasPrimaryLocation W16736434171 @default.
- W1673643417 hasRelatedWork W125622540 @default.
- W1673643417 hasRelatedWork W1992290574 @default.
- W1673643417 hasRelatedWork W2017797235 @default.
- W1673643417 hasRelatedWork W2036440418 @default.
- W1673643417 hasRelatedWork W2048998821 @default.
- W1673643417 hasRelatedWork W2066291030 @default.
- W1673643417 hasRelatedWork W2084878141 @default.
- W1673643417 hasRelatedWork W2108282017 @default.
- W1673643417 hasRelatedWork W2153965615 @default.
- W1673643417 hasRelatedWork W2743174471 @default.
- W1673643417 hasVolume "260" @default.
- W1673643417 isParatext "false" @default.
- W1673643417 isRetracted "false" @default.
- W1673643417 magId "1673643417" @default.
- W1673643417 workType "article" @default.