FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W1827308173> ?p ?o ?g. }

• W1827308173 endingPage "8901" @default.
• W1827308173 startingPage "8895" @default.
• W1827308173 abstract "Bioinformatics tools are helpful for epitopes prediction directly from the genomes of pathogens in order to design a vaccine. Epitopes are sub-sequences of proteins (8 to 10 mer peptides) which bind to MHC to interact with the T cell receptors and stimulate immune responses. Finding a suitable vaccine against Helicobacter pylori is necessary, because of high prevalence of the infection (25 to 90%). Moreover, this bacteria has been classified as a grade I carcinogen by WHO since 1994. Catalase, an important enzyme in the virulence of H. pylori, could be a suitable candidate for vaccine design because it is highly conserved, which is important for the survival of H. pylori; it is expressed in high level and it is exposed on the surface of the bacteria. In this study, we designed epitope-based vaccine for catalasespecific regions of H. pylori by means of immunobioinformatic tools. H. pylori(26695) catalase has been compared with human catalase in order to select specific regions. Afterwards, epitopes of catalase were determined by propred software. Among predicted epitopes, three epitopes were selected including, MVNKDVKQTT, VLLQSTWFL and FHPFDVTKI. Three candidates out of 51catalase antigen epitopes had the highest score for reactivating with MHC II MHC in propred software. The candidate epitopes for vaccine design should be rather a composition of considering epitopes: MVNKDVKQTTKKVLLQSTWFLKKFHPFDVTKI. In this manner, 39 of 51 alleles of MHC class ІІ were involved and stimulated T-cell responses. We believe prediction of catalase epitopes by the immunoinformatics tools would be valuable for developing new immuoprophylatic strategy against H. pylori infection.   Key words: Helicobacter pylori, catalase, epitopes." @default.
• W1827308173 created "2016-06-24" @default.
• W1827308173 creator A5038216289 @default.
• W1827308173 creator A5045896516 @default.
• W1827308173 creator A5053238431 @default.
• W1827308173 creator A5069829419 @default.
• W1827308173 date "2011-08-15" @default.
• W1827308173 modified "2023-10-11" @default.
• W1827308173 title "Catalase epitopes vaccine design for Helicobacter pylori: A bioinformatics approach" @default.
• W1827308173 cites W182912521 @default.
• W1827308173 cites W1853104928 @default.
• W1827308173 cites W1899216264 @default.
• W1827308173 cites W1965435557 @default.
• W1827308173 cites W2030994357 @default.
• W1827308173 cites W2039172015 @default.
• W1827308173 cites W2043633676 @default.
• W1827308173 cites W2049315968 @default.
• W1827308173 cites W2060333218 @default.
• W1827308173 cites W2066293700 @default.
• W1827308173 cites W2074061926 @default.
• W1827308173 cites W2075364188 @default.
• W1827308173 cites W2076244798 @default.
• W1827308173 cites W2121049963 @default.
• W1827308173 cites W2129645777 @default.
• W1827308173 cites W2141018096 @default.
• W1827308173 cites W2142636897 @default.
• W1827308173 cites W2143140859 @default.
• W1827308173 cites W2148482847 @default.
• W1827308173 cites W2148859463 @default.
• W1827308173 cites W2150181253 @default.
• W1827308173 cites W2151092333 @default.
• W1827308173 cites W2163030614 @default.
• W1827308173 cites W2169996212 @default.
• W1827308173 cites W2187824399 @default.
• W1827308173 cites W2295571529 @default.
• W1827308173 cites W2181614341 @default.
• W1827308173 doi "https://doi.org/10.5897/ajb11.741" @default.
• W1827308173 hasPublicationYear "2011" @default.
• W1827308173 type Work @default.
• W1827308173 sameAs 1827308173 @default.
• W1827308173 citedByCount "6" @default.
• W1827308173 countsByYear W18273081732015 @default.
• W1827308173 countsByYear W18273081732017 @default.
• W1827308173 countsByYear W18273081732018 @default.
• W1827308173 countsByYear W18273081732020 @default.
• W1827308173 countsByYear W18273081732023 @default.
• W1827308173 crossrefType "journal-article" @default.
• W1827308173 hasAuthorship W1827308173A5038216289 @default.
• W1827308173 hasAuthorship W1827308173A5045896516 @default.
• W1827308173 hasAuthorship W1827308173A5053238431 @default.
• W1827308173 hasAuthorship W1827308173A5069829419 @default.
• W1827308173 hasBestOaLocation W18273081731 @default.
• W1827308173 hasConcept C147483822 @default.
• W1827308173 hasConcept C195616568 @default.
• W1827308173 hasConcept C203014093 @default.
• W1827308173 hasConcept C207936829 @default.
• W1827308173 hasConcept C2776409635 @default.
• W1827308173 hasConcept C54355233 @default.
• W1827308173 hasConcept C70721500 @default.
• W1827308173 hasConcept C86803240 @default.
• W1827308173 hasConcept C89423630 @default.
• W1827308173 hasConceptScore W1827308173C147483822 @default.
• W1827308173 hasConceptScore W1827308173C195616568 @default.
• W1827308173 hasConceptScore W1827308173C203014093 @default.
• W1827308173 hasConceptScore W1827308173C207936829 @default.
• W1827308173 hasConceptScore W1827308173C2776409635 @default.
• W1827308173 hasConceptScore W1827308173C54355233 @default.
• W1827308173 hasConceptScore W1827308173C70721500 @default.
• W1827308173 hasConceptScore W1827308173C86803240 @default.
• W1827308173 hasConceptScore W1827308173C89423630 @default.
• W1827308173 hasIssue "44" @default.
• W1827308173 hasLocation W18273081731 @default.
• W1827308173 hasOpenAccess W1827308173 @default.
• W1827308173 hasPrimaryLocation W18273081731 @default.
• W1827308173 hasRelatedWork W1558421445 @default.
• W1827308173 hasRelatedWork W1587907511 @default.
• W1827308173 hasRelatedWork W1596377987 @default.
• W1827308173 hasRelatedWork W1991276946 @default.
• W1827308173 hasRelatedWork W2005276320 @default.
• W1827308173 hasRelatedWork W2068694905 @default.
• W1827308173 hasRelatedWork W26090337 @default.
• W1827308173 hasRelatedWork W2953549230 @default.
• W1827308173 hasRelatedWork W3031211151 @default.
• W1827308173 hasRelatedWork W4200059034 @default.
• W1827308173 hasVolume "10" @default.
• W1827308173 isParatext "false" @default.
• W1827308173 isRetracted "false" @default.
• W1827308173 magId "1827308173" @default.
• W1827308173 workType "article" @default.