FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W1969766188> ?p ?o ?g. }

• W1969766188 endingPage "179" @default.
• W1969766188 startingPage "174" @default.
• W1969766188 abstract "We report a functional protease assay in which liquid crystals (LCs) are used as signal reporters to transduce the test results into optical signals. In this assay, an oligopeptide substrate (CLSELDDRADALQAGASQFESSAAKLKRKYWWKNLK) is used as a probe. This oligopeptide can be cleaved by α-chymotrypsin at multiple locations and become smaller fragments after the cleavage. When the original oligopeptide is immobilized on a solid surface, its long flexible oligopeptide chain is able to influence the orientation of a thin layer of LC supported on the surface, as is evident as a bright spot on the surface. In contrast, when the shorter oligopeptide fragments are immobilized on the same surface, their shorter, less flexible chains cannot disrupt the orientation of LC, and a dark spot is observed. On the basis of the dark or bright signal from LC, α-chymotrypsin in buffer solution or complex media such as chicken broth can be detected by using the naked eye. However, when the incubation time is 3 h, the limit of detection (LOD) for α-chymotrypsin in buffer solution is 50 ng/mL, whereas that in chicken broth is only 500 ng/mL. Unlike traditional antibody-based assays which show little difference between active and inactive α-chymotrypsin, only active protease can be detected in this assay. This study shows the potential utility of LCs for detecting functional proteases with good specificity and sensitivity." @default.
• W1969766188 created "2016-06-24" @default.
• W1969766188 creator A5009217816 @default.
• W1969766188 creator A5067391587 @default.
• W1969766188 date "2012-05-01" @default.
• W1969766188 modified "2023-09-26" @default.
• W1969766188 title "Functional protease assay using liquid crystals as a signal reporter" @default.
• W1969766188 cites W1819870217 @default.
• W1969766188 cites W1971689738 @default.
• W1969766188 cites W1974278448 @default.
• W1969766188 cites W1976635350 @default.
• W1969766188 cites W1976781472 @default.
• W1969766188 cites W1981807819 @default.
• W1969766188 cites W1992411226 @default.
• W1969766188 cites W1995997874 @default.
• W1969766188 cites W1999295051 @default.
• W1969766188 cites W2017186716 @default.
• W1969766188 cites W2018400133 @default.
• W1969766188 cites W2020912695 @default.
• W1969766188 cites W2023242487 @default.
• W1969766188 cites W2056463268 @default.
• W1969766188 cites W2062819748 @default.
• W1969766188 cites W2064881757 @default.
• W1969766188 cites W2067395888 @default.
• W1969766188 cites W2077778159 @default.
• W1969766188 cites W2080978123 @default.
• W1969766188 cites W2083184845 @default.
• W1969766188 cites W2086363407 @default.
• W1969766188 cites W2093662543 @default.
• W1969766188 cites W2100566721 @default.
• W1969766188 cites W2104270610 @default.
• W1969766188 cites W2146886475 @default.
• W1969766188 cites W2156047282 @default.
• W1969766188 cites W2156593398 @default.
• W1969766188 cites W2163523761 @default.
• W1969766188 cites W2320766193 @default.
• W1969766188 doi "https://doi.org/10.1016/j.bios.2012.02.042" @default.
• W1969766188 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/22444513" @default.
• W1969766188 hasPublicationYear "2012" @default.
• W1969766188 type Work @default.
• W1969766188 sameAs 1969766188 @default.
• W1969766188 citedByCount "13" @default.
• W1969766188 countsByYear W19697661882013 @default.
• W1969766188 countsByYear W19697661882014 @default.
• W1969766188 countsByYear W19697661882017 @default.
• W1969766188 countsByYear W19697661882018 @default.
• W1969766188 countsByYear W19697661882020 @default.
• W1969766188 countsByYear W19697661882021 @default.
• W1969766188 countsByYear W19697661882022 @default.
• W1969766188 crossrefType "journal-article" @default.
• W1969766188 hasAuthorship W1969766188A5009217816 @default.
• W1969766188 hasAuthorship W1969766188A5067391587 @default.
• W1969766188 hasConcept C119128265 @default.
• W1969766188 hasConcept C13935069 @default.
• W1969766188 hasConcept C151730666 @default.
• W1969766188 hasConcept C175156509 @default.
• W1969766188 hasConcept C181199279 @default.
• W1969766188 hasConcept C182220744 @default.
• W1969766188 hasConcept C185592680 @default.
• W1969766188 hasConcept C18903297 @default.
• W1969766188 hasConcept C2776714187 @default.
• W1969766188 hasConcept C2777289219 @default.
• W1969766188 hasConcept C2778401398 @default.
• W1969766188 hasConcept C2779281246 @default.
• W1969766188 hasConcept C2780340462 @default.
• W1969766188 hasConcept C43369102 @default.
• W1969766188 hasConcept C43617362 @default.
• W1969766188 hasConcept C55493867 @default.
• W1969766188 hasConcept C86803240 @default.
• W1969766188 hasConceptScore W1969766188C119128265 @default.
• W1969766188 hasConceptScore W1969766188C13935069 @default.
• W1969766188 hasConceptScore W1969766188C151730666 @default.
• W1969766188 hasConceptScore W1969766188C175156509 @default.
• W1969766188 hasConceptScore W1969766188C181199279 @default.
• W1969766188 hasConceptScore W1969766188C182220744 @default.
• W1969766188 hasConceptScore W1969766188C185592680 @default.
• W1969766188 hasConceptScore W1969766188C18903297 @default.
• W1969766188 hasConceptScore W1969766188C2776714187 @default.
• W1969766188 hasConceptScore W1969766188C2777289219 @default.
• W1969766188 hasConceptScore W1969766188C2778401398 @default.
• W1969766188 hasConceptScore W1969766188C2779281246 @default.
• W1969766188 hasConceptScore W1969766188C2780340462 @default.
• W1969766188 hasConceptScore W1969766188C43369102 @default.
• W1969766188 hasConceptScore W1969766188C43617362 @default.
• W1969766188 hasConceptScore W1969766188C55493867 @default.
• W1969766188 hasConceptScore W1969766188C86803240 @default.
• W1969766188 hasIssue "1" @default.
• W1969766188 hasLocation W19697661881 @default.
• W1969766188 hasLocation W19697661882 @default.
• W1969766188 hasOpenAccess W1969766188 @default.
• W1969766188 hasPrimaryLocation W19697661881 @default.
• W1969766188 hasRelatedWork W17428494 @default.
• W1969766188 hasRelatedWork W2041130219 @default.
• W1969766188 hasRelatedWork W2071830264 @default.
• W1969766188 hasRelatedWork W2081147128 @default.
• W1969766188 hasRelatedWork W2091245340 @default.
• W1969766188 hasRelatedWork W2127406568 @default.
• W1969766188 hasRelatedWork W2179790758 @default.

• next