FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W1973417881> ?p ?o ?g. }

• W1973417881 endingPage "45792" @default.
• W1973417881 startingPage "45785" @default.
• W1973417881 abstract "In addition to its involvement in the formation of the capsid shell of the virus particles, the core protein of hepatitis C virus (HCV) is believed to play an important role in the pathogenesis and/or establishment of persistent infection. We describe here alternative forms of genotype 1b HCV core protein identified after purification of various products of core protein segment 1-169 expressed in Escherichia coli and their analysis by proteolysis, mass spectrometry, and amino acid sequencing. These proteins all result from a +1 frameshift at codon 42 (a different position than that previously reported in genotype 1a) and, for some of them, from a rephasing in the normal open reading frame at the termination codon 144 in the +1 open reading frame. To test the relevance of these recoding events in a eukaryotic translational context, the nucleotide sequences surrounding the two shift sites were cloned in the three reading frames into expression vectors, allowing the production of a C-terminally fused green fluorescent protein, and expressed both in a reticulocyte lysate transcription/translation assay and in culture cells. Both recoding events were confirmed in these expression systems, strengthening the hypothesis that they might occur in HCV-infected cells. Moreover, sera from HCV-positive patients of genotype 1a or 1b were shown to react differently against synthetic peptides encoded in the +1 open reading frame. Together, these results indicate the occurrence of distinct recoding events in genotypes 1a and 1b, pointing out genotype-dependent specific features for F protein. In addition to its involvement in the formation of the capsid shell of the virus particles, the core protein of hepatitis C virus (HCV) is believed to play an important role in the pathogenesis and/or establishment of persistent infection. We describe here alternative forms of genotype 1b HCV core protein identified after purification of various products of core protein segment 1-169 expressed in Escherichia coli and their analysis by proteolysis, mass spectrometry, and amino acid sequencing. These proteins all result from a +1 frameshift at codon 42 (a different position than that previously reported in genotype 1a) and, for some of them, from a rephasing in the normal open reading frame at the termination codon 144 in the +1 open reading frame. To test the relevance of these recoding events in a eukaryotic translational context, the nucleotide sequences surrounding the two shift sites were cloned in the three reading frames into expression vectors, allowing the production of a C-terminally fused green fluorescent protein, and expressed both in a reticulocyte lysate transcription/translation assay and in culture cells. Both recoding events were confirmed in these expression systems, strengthening the hypothesis that they might occur in HCV-infected cells. Moreover, sera from HCV-positive patients of genotype 1a or 1b were shown to react differently against synthetic peptides encoded in the +1 open reading frame. Together, these results indicate the occurrence of distinct recoding events in genotypes 1a and 1b, pointing out genotype-dependent specific features for F protein. Hepatitis C virus (HCV) 1The abbreviations used are: HCV, hepatitis C virus; Ni-NTA, nickel-nitrilotriacetic acid; HPLC, high pressure liquid chromatography; LC, liquid chromatography; MS, mass spectrometry; GFP, green fluorescent protein; ORF, open reading frame. is estimated to chronically infect roughly 170 million people worldwide (1World Health OrganizationWeekly Epidemiol. Rep. 1997; 72: 65-72PubMed Google Scholar) and is a major public health problem because chronic infection may lead to severe liver diseases including cirrhosis and hepatocellular carcinoma. HCV has a positive-sense, single-stranded RNA genome of ∼9.6 kb and is a member of the Flaviviridae (2Choo Q.L. Richman K.H. Han J.H. Berger K. Lee C. Dong C. Gallegos C. Coit D. Medina-Selby R. Barr P.J. Weiner A.J. Bradley D.W. Kuo G. Houghton M. Proc. Natl. Acad. Sci. U. S. A. 1991; 88: 2451-2455Crossref PubMed Scopus (1532) Google Scholar, 3Robertson B. Myers G. Howard C. Brettin T. Bukh J. Gaschen B. Gojobori T. Maertens G. Mizokami M. Nainan O. Netesov S. Nishioka K. Shin i T. Simmonds P. Smith D. Stuyver L. Weiner A. Arch. Virol. 1998; 143: 2493-2503Crossref PubMed Scopus (437) Google Scholar). The genome encodes a polyprotein of some 3,000 amino acids, which is post-translationally cleaved by viral and cellular proteases to generate at least 10 viral proteins identified as structural proteins (C, E1, E2, and P7) and nonstructural proteins (NS2, NS3, NS4a, NS4b, NS5a, and NS5b) (for a review see Refs. 4Reed K.E. Rice C.M. Curr. Top Microbiol. Immunol. 2000; 242: 55-84Crossref PubMed Scopus (477) Google Scholar and 5Penin F. Clin. Liver Dis. 2003; 7: 1-21Abstract Full Text Full Text PDF PubMed Scopus (28) Google Scholar). The translation of the HCV polyprotein is regulated by the highly structured 5′-noncoding region acting as an internal ribosome entry site (for a review see Ref. 6Rijnbrand R.C.A. Lemon S.M. Curr. Top Microbiol. Immunol. 2000; 242: 85-116PubMed Google Scholar). The HCV core protein is 191 amino acids in length and consists of three distinct predicted domains: an N-terminal two-third domain of highly positively charged amino acids, a C-terminal one-third domain of hydrophobic residues, and the last 20 or so residues serving as the signal peptide for the downstream protein E1 (7Grakoui A. Wychowski C. Lin C. Feinstone S.M. Rice C.M. J. Virol. 1993; 67: 1385-1395Crossref PubMed Google Scholar, 8Harada S. Watanabe Y. Takeuchi K. Suzuki T. Katayama T. Takebe Y. Saito I. Miyamura T. J. Virol. 1991; 65: 3015-3021Crossref PubMed Google Scholar, 9McLauchlan J. J. Viral. Hepat. 2000; 7: 2-14Crossref PubMed Scopus (265) Google Scholar, 10Lai M.C.C. Ware C.F. Curr. Top Microbiol. Immunol. 2000; 242: 117-134Crossref PubMed Scopus (109) Google Scholar). The initial polyprotein cleavage generates the immature core protein (P23) that undergoes additional processing by the intramembrane-cleaving protease SPP (signal peptide peptidase) (11McLauchlan J. Lemberg M.K. Hope G. Martoglio B. EMBO J. 2002; 21: 3980-3988Crossref PubMed Scopus (395) Google Scholar). This yields mature core P21, whose C terminus is not precisely known but lies between residues 172 and 182 (11McLauchlan J. Lemberg M.K. Hope G. Martoglio B. EMBO J. 2002; 21: 3980-3988Crossref PubMed Scopus (395) Google Scholar, 12Santolini E. Migliaccio G. La Monica N. J. Virol. 1994; 68: 3631-3641Crossref PubMed Google Scholar, 13Hussy P. Langen H. Mous J. Jacobsen H. Virology. 1996; 224: 93-104Crossref PubMed Scopus (127) Google Scholar). It has been shown that alternative form(s) of the HCV core protein could be produced as a result of a -2/+1 ribosomal frameshift at or near codon 11 in genotype 1a (14Walewski J.L. Keller T.R. Stump D.D. Branch A.D. RNA. 2001; 7: 710-721Crossref PubMed Scopus (223) Google Scholar, 15Xu Z. Choi J. Yen T.S. Lu W. Strohecker A. Govindarajan S. Chien D. Selby M.J. Ou J. EMBO J. 2001; 20: 3840-3848Crossref PubMed Scopus (244) Google Scholar, 16Varaklioti A. Vassilaki N. Georgopoulou U. Mavromara P. J. Biol. Chem. 2002; 277: 17713-17721Abstract Full Text Full Text PDF PubMed Scopus (129) Google Scholar, 17Roussel J. Pillez A. Montpellier C. Duverlie G. Cahour A. Dubuisson J. Wychowski C. J. Gen. Virol. 2003; 84: 1751-1759Crossref PubMed Scopus (46) Google Scholar). Walewski et al. (14Walewski J.L. Keller T.R. Stump D.D. Branch A.D. RNA. 2001; 7: 710-721Crossref PubMed Scopus (223) Google Scholar) stated that a cluster of unusually conserved synonymous codons in this core-coding region indicated a potential overlapping open reading frame. Specific IgGs for three of four peptides derived from this alternate reading frame protein were detected in chronic HCV sera. Xu et al. (15Xu Z. Choi J. Yen T.S. Lu W. Strohecker A. Govindarajan S. Chien D. Selby M.J. Ou J. EMBO J. 2001; 20: 3840-3848Crossref PubMed Scopus (244) Google Scholar) reported both the in vitro and the in vivo synthesis of a 17-kDa core protein resulting from a -2/+1 ribosomal frameshift that was named “F protein.” Here again, antibodies specific for this protein were detected in sera from HCV-infected patients. F protein might be related to a 16-17-kDa protein (P16) previously observed in mammalian cells expression studies in addition to P21 and P23 and initially thought to be a truncated form of core protein (18Lo S.Y. Masiarz F. Hwang S.B. Lai M.M. Ou J.H. Virology. 1995; 213: 455-461Crossref PubMed Scopus (148) Google Scholar). More recently, Choi et al. (19Choi J. Xu Z. Ou J.H. Mol. Cell Biol. 2003; 23: 1489-1497Crossref PubMed Scopus (53) Google Scholar) reported the possibility of multiple frameshifting events at or around codon 11 in core sequence of genotype 1a. In addition to the F protein caused by -2/+1 frameshifting, a 1.5-kDa protein could also be produced by -1/+2 frameshifting. We report here the production in Escherichia coli of alternative forms of the HCV core protein from genotype 1b resulting from a +1 ribosomal frameshift at codon 42 that can be followed by a rephasing in the 0 frame that bypass the stop codon at position 144. The exact positions of both of these recoding events were determined by amino acid sequencing and mass spectrometry. The ability of the corresponding nucleotide sequences surrounding the shift sites to induce recoding in a eukaryotic translational context was demonstrated both by an in vitro transcription/translation assay in a reticulocyte lysate and by expression in culture cells. Finally, immunological analysis using various synthetic peptides revealed the presence of antibodies directed against the +1 core reading frame in several sera of HCV-positive patients of genotype 1a or 1b. However, the differences of reactivity against these peptides support our finding that the frameshifting site leading to F protein is different in genotypes 1a and 1b. Plasmid Construction and Protein Purification—A 507-bp fragment corresponding to amino acids 1-169 of the HCV core protein (CHCV1-169) was amplified by PCR from sequence with EMBL accession number D89872 encoded by the plasmid PCMV-C980 (a gift from Dr. Shimotohno) and two specific primers containing a NdeI site or a PstI site, respectively. The NdeI-PstI fragment was cloned into the expression vector pT7-7 (His6) (20Cortay J.C. Negre D. Scarabel M. Ramseier T.M. Vartak N.B. Reizer J. Saier Jr., M.H. Cozzone A.J. J. Biol. Chem. 1994; 269: 14885-14891Abstract Full Text PDF PubMed Google Scholar). CHCV1-169 carrying a polyhistidine fused to the C terminus (CHCV1-169(His6)) was expressed from the resulting plasmid after transformation in the E. coli strain BL21 SI (Invitrogen) producing T7 RNA polymerase. E. coli BL21 SI was transformed with the plasmid, and transformants were grown at 37 °C in LB medium without NaCl until the culture reached an A 600 of 0.7. Expression was induced by adding NaCl to a final concentration of 200 mm. Incubation was continued for a further 3 h. The cells were harvested by centrifugation at 5,500 × g for 10 min at 4 °C and then resuspended in 25 mm Tris-HCl, pH 7.5, 5 mm MgCl2, 1 mm dithiothreitol, 1 mm phenylmethylsulfonyl fluoride, and 100 units/ml benzonase. The cells were lysed using an SLM-Aminco French press at 1,200 p.s.i. followed by centrifugation at 30,000 × g for 30 min. The pellet was resuspended in 20 mm Tris-HCl, pH 8.0, 500 mm NaCl, 6 m urea, 10 mm β-mercaptoethanol, and 0.1% dodecylmaltoside (Buffer A), then homogenized by sonication, and centrifuged at 24,000 × g for 20 min. The supernatant was collected, and the pellet was submitted to a second urea extraction as described above. Both supernatants were pooled and loaded over a Ni-NTA-agarose column (Qiagen) previously equilibrated with buffer A. The column was washed with 3 volumes of buffer A and then with 3 volumes of buffer A containing 10 mm imidazole, and the proteins were eluted with buffer A containing 250 mm imidazole. The fractions containing CHCV1-169(His6) were pooled and subjected to reversed phase HPLC on a VYDAC C8 column (300 Å, 10 μm, 10 × 250 mm) equipped with a C8 Aquapore guard column (Brownlee, 4.6 × 30 mm) using a linear gradient of acetonitrile in 10% trifluoroacetic acid at 1.5 ml/min flow rate. The linear gradient steps were performed using Waters 510 HPLC pumps as follows: 0 min, 25% acetonitrile; 0-5 min, 35% acetonitrile; 5-20 min, 50% acetonitrile; 20-50 min, 60% acetonitrile; and 50-60 min, 100% acetonitrile. Chromatography was monitored at 220 and 280 nm using a Waters 991 photodiode array detector. Proteins corresponding to the main peaks were lyophilized and identified by mass spectrometry and N-terminal sequencing. Mass Spectrometry and Peptide Sequencing—All liquid chromatography/mass spectrometry (LC/MS) analyses were carried out using a Sciex API 165 quadrupole mass spectrometer coupled to an Applied Biosystem ABI 140D capillary LC system. The mass spectrometer was operated using two electrospray ionization sources (microspray and ionspray) in the positive ion mode. The microspray source was used for the direct infusion of protein solutions with 0.2 μl/min flow rate in a CH3OH/H2O (50/50, v/v) mixture containing 0.1% of HCOOH. LC/MS was carried out on a C18 HPLC microcolumn (Brownlee, 150 × 0.5-mm inner diameter, 5-μm particle size, 300-Å pore) at a flow rate of 10 μl/min connected to a 785A absorbance detector (Applied Biosystems) and an ionspray source. The V8-digested peptides were separated using mobile phases A and B with a four-step linear gradient of 10% B in the first 5 min, followed by 10-70% B in the next 60 min, and then 70-95% B for 10 min and hold at 95% B in the last 10 min (mobile phase A, 0.05% trifluoroacetic acid in H2O; mobile phase B, 0.04% trifluoroacetic acid in CH3CN/H2O, (90/10, v/v). Absorbance detection was set at 214 nm. The scan range was set at m/z 700-2200. The peptides were sequenced by automatic Edman degradation using a Procise 492A liquid phase sequencer (Applied Biosystems). In Vitro Transcription and Translation—A DNA fragment from nucleotide 100 to nucleotide 200 of the HCV core protein coding sequence was inserted into the unique NheI cloning site of the plasmid pQBI T7-GFP (Quantum Biotechnologies). This construct allows the expression, under the control of a T7 promoter, of the green fluorescent protein (GFP) fused to the C terminus of the inserted sequence (Fig. 1). The resulting plasmids were used for in vitro transcription/translation assays in reticulocyte lysates (TnT® T7 reticulocyte lysate; Promega) containing 20 μCi of [35S]methionine (>1000 Ci/mmol) according to the manufacturer's instructions. The same constructions were made with a DNA sequence from nucleotide 412 to nucleotide 480 (Fig. 1). The resulting plasmids were used for in vitro transcription/translation assays in a reticulocyte lysate as described above. For immunoprecipitation, monoclonal anti-GFP antibody (monoclonal antibody 3E6; Q.BIOgene) was conjugated to protein A-Sepharose for 1 h at 4 °C in phosphate-buffered saline buffer. Antibody-conjugated beads were then equilibrated in nondenaturing lysis buffer (1% Triton (w/v), 50 mm Tris-HCl, pH 7.4, 300 mm NaCl, 5 mm EDTA, 1 mm phenylmethylsulfonyl fluoride) and added to 10 μl of reticulocyte lysate in 500 μl of nondenaturing lysis buffer for 1 h at 4 °C. After repeated washing with wash buffer (lysis buffer containing 0.1% Triton), the proteins were eluted with Laemmli sample buffer. The immunoprecipitated proteins were analyzed by SDS-PAGE, autoradiographed, and scanned using a STORM 860 (Molecular Dynamics) PhosphorImager. Expression in Culture Cells—The DNA fragments described above and used to test the ability of the corresponding RNA sequences to direct frameshifting in a reticulocyte lysate assay were used for cellular expression. They were cloned into the unique NheI site of the plasmid pQBI25-fPA (Quantum Biotechnologies). These constructs allow the expression, under the control of a cytomegalovirus promoter, of GFP fused to the C terminus of the inserted sequence (Fig. 1). HeLa cells were grown and maintained in Glasgow minimal Eagle's medium supplemented with 10% fetal calf serum and 100 IU/ml penicillin/streptomycin (Sigma). For transfection, the cells were washed, treated with trypsin and plated in an 8-chamber culture slide (Falcon) at the required density in a humidified CO2 incubator (5%) at 37 °C overnight. The cells were transfected by calcium phosphate according to the manufacturer's instructions (Invitrogen). 16 h after transfection, the cells were fixed by 4% paraformaldehyde in phosphate-buffered saline at 4 °C for 30 min, and the nuclei were stained in phosphate-buffered saline containing 5 μg/ml Hoechst 33258 (Sigma). Fluorescence microscopy was performed using a Zeiss Axioplan 2 microscope. Immunoblotting—Samples were separated by SDS-PAGE and electrotransferred to nitrocellulose membranes with a blotting apparatus (Bio-Rad). The membranes were blocked with 5% nonfat dry milk in phosphate-buffered saline at room temperature for 1 h. Monoclonal anti-core antibody (AbCys) (1/5,000 dilution) and phosphatase alkaline-labeled goat anti-mouse immunoglobulin G IgG (H+L) (1/1,000 dilution; Bio-Rad) were used to detect the expression of HCV core protein. A SuperSignal® West HisProbe™ Kit (Pierce) was used to detect His6-tagged proteins according to the manufacturer's instructions. Enzyme Immunoassay—Three synthetic peptides encoded in the +1 ORF of core and predicted to be antigenic were obtained by chemical synthesis: peptide F1 (core (11-25), NVTPTAAHRTLSSRA), peptide F2 (Core (46-60), ARLGRLPSGRNLVEG), and peptide F3 (Core (106-120), GAPQTPGVGRVIWVR). For the enzyme immunoassay, the wells of a microtiter plate were coated with 0.5 μg of peptide and incubated with 10 μl of human serum and 90 μl of diluent at room temperature for 1 h. The wells were washed and subsequently incubated with 100 μl of a 1:3,000 dilution of a horseradish peroxidase-conjugated goat anti-human antibody (Pierce). The wells were washed again and allowed to react with 2,2′-azino-bis(3-ethylbenz-thiazoline-6-sulfonic acid) and H2O2 for color development. The reaction was analyzed at 405 nm in a Dynex MRX microplate reader. Identification of Alternative Forms of HCV Core Protein—Expression of a plasmid coding for the HCV core protein fragment CHCV1-169(His6) led to the production of protein found predominantly in the inclusion bodies. The proteins were extracted with 6 m urea in the presence of 10 mm β-mercaptoethanol, and the presence of polyhistidine fused to the C terminus permitted its purification on Ni-NTA-agarose. A second purification step on reverse phase HPLC permitted the separation of CHCV1-169(His6) (peak 5) from minor peaks (peaks 1-4) that represented about 35% of total protein (Fig. 2, A and B). Mass spectrometry analysis of peak 5 gave a molecular mass of 19,421 Da that corresponded to CHCV2-169(His6) (Table I) and thus indicated the removal of the N-terminal methionine residue. Analysis of minor peaks by immunoblotting showed that they all reacted with an antibody directed against the N terminus of the core protein (Fig. 2C) and with an anti-His6 antibody (Fig. 2D). Therefore, fractions 1-4 eluting earlier than CHCV2-169(His6) by reverse phase HPLC contained proteins harboring both the N and C termini of CHCV2-169(His6) but exhibiting a lower molecular mass. Mass spectrometry analysis gave molecular masses of 18,381 Da (peak 1), 18,282 Da (peak 2), 18,395 Da (peak 3), and 18,335 Da (peak 4) that were incompatible with proteolytic cleavages at the N terminus of CHCV2-169(His6) and represent alternative forms of CHCV2-169(His6) as demonstrated below. SDS-PAGE and immunoblot analysis also revealed that some of these proteins formed dimers that were resistant to SDS-PAGE (Fig. 2, B-D, lanes 1-3).Table IMass determination and amino acid sequencing of endoproteinase Glu-C cleavage productsCHCV(2-169)His6 (molecular mass 19,421 Da)aFragments of CHCV(2—169)His6 (peak 5) and of peak 3 (i.e. DFCHCV protein) resulting from 3 h of endoproteinase GluC proteolysis were submitted to LC/MS analysis and peptide sequencing as described under “Experimental Procedures”DFCHCV (peak 3) (molecular mass 18,395 Da)aFragments of CHCV(2—169)His6 (peak 5) and of peak 3 (i.e. DFCHCV protein) resulting from 3 h of endoproteinase GluC proteolysis were submitted to LC/MS analysis and peptide sequencing as described under “Experimental Procedures”MasssequenceMassSequence determinedbThe sequence underlined is coded by the +1 ORF. The sequence in bold italics was deduced from tryptic cleavage analysis by LC/MS (see the text)MeasuredCalculatedMeasuredPredicted5,929.03 ± 0.565,927.83STNPKPQRKTKRNTNRRPQDVKF6,539.01 ± 2.146,537.58STNPKPQRKTKRNTNPGGGQIVGGVYLLPRRGPRLGRRPQDVKFPGGGQIVGGVYLLPRRVRATRKTSEGPGWVCARLGRLP SGRNLVE2,185.81 ± 0.822,185.53RSQPRGRRQPIPKARRPE9,920.40 ± 1.259,918.41GDNLSPRLAGPRVGPGLSPGTLGPSMATRVWGGODGSCHPVALGLVGAPOTPGVGRVIWVRSSIPLHAASPTSWGTFRLSAPPLGGAARALAHGV RVLE1,992.42 ± 0.581,992.18GRTWAQPGYPWPLYGNE7,413.77 ± 1.507,413.64GMGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLE1,974.22 ± 0.271,975.04DGVNYATGNLQHHHHHH1,974.22 ± 0.271,975.04DGVNYATGNLQHHHHHHa Fragments of CHCV(2—169)His6 (peak 5) and of peak 3 (i.e. DFCHCV protein) resulting from 3 h of endoproteinase GluC proteolysis were submitted to LC/MS analysis and peptide sequencing as described under “Experimental Procedures”b The sequence underlined is coded by the +1 ORF. The sequence in bold italics was deduced from tryptic cleavage analysis by LC/MS (see the text) Open table in a new tab Alternative Core Proteins Result from Multiple Recoding Events—To obtain the full-length amino acid sequences, the protein eluting at peaks 1-4 from the HPLC chromatography (Fig. 2A) and CHCV2-169(His6) (Fig. 2A, peak 5) were submitted to V8 proteolysis. The patterns of V8 proteolysis of these proteins were very similar but were very different from that of CHCV2-169(His6) (result not shown). LC/MS analysis revealed that V8 fragments obtained from CHCV2-169(His6) had molecular masses identical to those predicted from their amino acid sequences (Table I). In the case of the alternative protein, the presence of a 1974-Da fragment corresponding to the C terminus of CHCV2-169(His6) confirmed the previous finding concerning the reactivity of this protein with an anti-His6 antibody (Fig. 2D). In contrast, fragments of 6539 and 9920 Da were not consistent with V8 proteolysis fragments of CHCV2-169(His6). Each of these two fragments was submitted to chemical amino acid sequencing. As shown in Table I, the 6539-Da fragment corresponded to the first 40 amino acids of CHCV2-169(His6) followed by 18 amino acids resulting from a +1 ribosomal frameshift in the core protein coding sequence. This frameshifting occurred at codon 42 in the core protein coding sequence and resulted in the reading of a GGU codon coding for Gly in the +1 ORF instead of the reading of an AGG codon coding for Arg in the 0 ORF (Fig. 3). The 9920-Da fragment was too long for complete sequencing but sequencing of its N terminus gave the sequence GDNLSPRL, corresponding to the continuation of translation in the +1 ORF (Table I). The presence of the 1,974 Da fragment corresponding to the C terminus in the 0 ORF strongly suggested the occurrence, in the 9,920 Da fragment, of a translational event leading to rephasing in the 0 ORF. This rephasing event should have occurred before or at the termination codon at position 144 in the +1 ORF. To test this hypothesis, extensive tryptic cleavage of the 9920-Da fragment was carried out, and the peptide mixture was analyzed by LC/MS. All of the fragments could be attributed to sequences in the 0 or +1 ORF except for a fragment at m/z 1,009.6 for [M+H]+ corresponding to the peptide straddling the rephasing site in the 0 ORF. Looking at the collision source fragmentation, we observed abundant and characteristic y ion fragments at m/z 896.5 (y10), 809.4 (y9), 738.5 (y8), 641.5 (y7), 544.4 (y6), and 431.4 (y5) according to the notation proposed by Roepstorff and Fohlman (21Roepstorff P. Fohlman J. Biomed. Mass Spectrom. 1984; 11: 601Crossref PubMed Scopus (2388) Google Scholar). These fragment ions corresponded to the amino acid sequence LSAPPL, which matched the predicted sequence LSAPPLGGAAR resulting from a -1 frameshift. The molecular mass of 9920 Da is consistent with the occurrence of a -1 frameshift at the UAG termination codon in the +1 ORF. This frameshift results in the reading of a CUA codon coding for Leu and allows translation to continue in the 0 ORF, leading to the recurrence of the usual C-terminal core protein sequence in the alternative protein (Fig. 3). In conclusion, the protein eluted at peak 3 results both from a +1 frameshift at codon 42 and a -1 frameshift at codon 144, leading to an alternative core protein containing the first 42 amino acids of the core protein, 101 residues coded by the +1 ORF, and then residues 144 to the His6 tag of the core protein. This protein is thus an alternative form of core and was named DFCHCV (double frameshifted core) protein. The other minor protein fractions eluting from HPLC chromatography (Fig. 2A, peaks 1, 2, and 4) were also submitted to extensive tryptic cleavage, and peptide mixtures were submitted to LC/MS. All of the fragments, including that corresponding to the +1 frameshift site at codon 42 could, in all cases, be attributed to sequences present in the DFC protein except for the fragment straddling the -1 frameshift site. As reported in Table II, the protein from peak 1 contained a tryptic peptide that could be attributed to two +1 frameshift events at codons 144 and 145 in the +1 ORF. The protein from peak 2 contained a tryptic peptide that could be attributed to a +2 frameshift event at codon 144 in the +1 ORF. Finally, the fraction from peak 4 contained a tryptic peptide that could be attributed to the same -1 frameshift, as observed in DFC protein (at codon 144) together with the bypass of the codon 145 or 146 (both of them coding for Gly). All of these events lead to a rephasing in the 0 ORF of the core coding sequence. Integration of the peaks from the reverse phase HPLC (Fig. 1) gave the following ratios: 68% for CHCV2-169(His6), 9% for peak 1, 3% for peak 2, 18% for peak 3, and 2% for peak 4. It is worth mentioning that the alternative core protein resulting from the +1 frameshift only (i.e. ending at the termination codon in the +1 ORF without occurrence of the -1 frameshift) was found in the flow through fraction of the Ni-NTA-agarose chromatography as expected because it did not harbor the C-terminal His6 tag. It was characterized by immunoprecipitation (using an anti-core antibody directed against the N terminus of core protein) followed by reverse phase HPLC purification and mass spectroscopy (data not shown). The ratio of this protein fraction was estimated to be equivalent to the sum of fractions from peaks 1 to 4.Table IIAmino acid sequences observed in alternative core proteins at the second frameshift site (termination codon 144 in the +1 ORF) Sequences Including the Shift Sites Direct Recoding Both in a Eukaryotic in Vitro Transcription/Translation Assay and in Culture Cells—To test the ability of the sequence including codon 42 (nucleotides 126-128) to direct +1 frameshifting in a eukaryotic translational context, the core DNA sequence from nucleotides 100 to 200 was inserted into a plasmid upstream from the gene coding for GFP used as a reporter protein. Three constructs were made for which the DNA coding for GFP was fused in the three reading frames with regard to the upstream inserted sequence (Fig. 1). As can be seen in Fig. 4A, expression of the resulting plasmids in a reticulocyte lysate yielded a large amount of fused GFP cloned in the 0 frame (lane 4). Interestingly, a low but detectable amount of fused GFP cloned in the -1 frame attests for the occurrence of a +1 frameshifting (lane 3). In contrast, no fused GFP cloned in the +1 frame was detected (lane 5). These results are to be compared with a blank without plasmid (lane 1) and with the control GFP plasmid (lane 2). The amount of +1 frameshifting was determined to be 1.9% when compared with the product of the control GFP plasmid taken as 100% (Fig. 4B, lanes 3 and 2, respectively). The core DNA sequence used in the in vitro reticulocyte lysate assay described above were cloned into a plasmid, permitting the production of fused GFP under the control of a cytomegalovirus promoter in eukaryotic cells (Fig. 1). As can be seen in Fig. 5, the results obtained confirmed those obtained in the reticulocyte lysate assay. The sequence used to test the occurrence of a +1 frameshifting led to the production of GFP in the cells when the protein was cloned either in the -1 frame (Fig. 5A) or in the 0 frame (Fig. 5B) but did not lead to the production of GFP when it was cloned in the +1 frame (Fig. 5C). Hence this sequence is able to direct +1 ribosomal frameshifting in a cellular context.Fig. 5Cellular expression of the GFP fusion constructs. Templates for the recoding assays were constructed as described under “Experimental Procedures” (see also Fig. 2). The cells were transfected with these constructs and observed by microscopy for the fluorescence of the GFP fusion proteins. A, pQBI25-42(-1); B, pQBI25-42 (0); C, pQBI25-42(+1); D, pQBI25-144(-1); E, pQBI25-144 (0); F, pQBI25-144(+1).View Large Image Figure ViewerDownload Hi-res image Download (PPT) Concerning the -1 frameshift at codon 144 (nu" @default.
• W1973417881 created "2016-06-24" @default.
• W1973417881 creator A5013052313 @default.
• W1973417881 creator A5034684791 @default.
• W1973417881 creator A5042762405 @default.
• W1973417881 creator A5069548197 @default.
• W1973417881 date "2003-11-01" @default.
• W1973417881 modified "2023-10-14" @default.
• W1973417881 title "Unusual Multiple Recoding Events Leading to Alternative Forms of Hepatitis C Virus Core Protein from Genotype 1b" @default.
• W1973417881 cites W1495926848 @default.
• W1973417881 cites W1548869612 @default.
• W1973417881 cites W1796179288 @default.
• W1973417881 cites W1957867949 @default.
• W1973417881 cites W1964662564 @default.
• W1973417881 cites W1969728880 @default.
• W1973417881 cites W1972846278 @default.
• W1973417881 cites W2006757932 @default.
• W1973417881 cites W2010425539 @default.
• W1973417881 cites W2016870326 @default.
• W1973417881 cites W2029038593 @default.
• W1973417881 cites W2040843640 @default.
• W1973417881 cites W2045301284 @default.
• W1973417881 cites W2065313571 @default.
• W1973417881 cites W2068559087 @default.
• W1973417881 cites W2070860744 @default.
• W1973417881 cites W2078964482 @default.
• W1973417881 cites W2089829321 @default.
• W1973417881 cites W2092308088 @default.
• W1973417881 cites W2098079636 @default.
• W1973417881 cites W2106132583 @default.
• W1973417881 cites W2124528668 @default.
• W1973417881 cites W2138172337 @default.
• W1973417881 cites W2147427891 @default.
• W1973417881 cites W2149294770 @default.
• W1973417881 cites W2149781618 @default.
• W1973417881 cites W2155431764 @default.
• W1973417881 cites W2160425277 @default.
• W1973417881 cites W2161229339 @default.
• W1973417881 cites W3164064520 @default.
• W1973417881 doi "https://doi.org/10.1074/jbc.m307174200" @default.
• W1973417881 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/12952944" @default.
• W1973417881 hasPublicationYear "2003" @default.
• W1973417881 type Work @default.
• W1973417881 sameAs 1973417881 @default.
• W1973417881 citedByCount "77" @default.
• W1973417881 countsByYear W19734178812012 @default.
• W1973417881 countsByYear W19734178812013 @default.
• W1973417881 countsByYear W19734178812014 @default.
• W1973417881 countsByYear W19734178812015 @default.
• W1973417881 countsByYear W19734178812016 @default.
• W1973417881 countsByYear W19734178812017 @default.
• W1973417881 countsByYear W19734178812018 @default.
• W1973417881 countsByYear W19734178812020 @default.
• W1973417881 crossrefType "journal-article" @default.
• W1973417881 hasAuthorship W1973417881A5013052313 @default.
• W1973417881 hasAuthorship W1973417881A5034684791 @default.
• W1973417881 hasAuthorship W1973417881A5042762405 @default.
• W1973417881 hasAuthorship W1973417881A5069548197 @default.
• W1973417881 hasBestOaLocation W19734178811 @default.
• W1973417881 hasConcept C104317684 @default.
• W1973417881 hasConcept C135763542 @default.
• W1973417881 hasConcept C159047783 @default.
• W1973417881 hasConcept C2164484 @default.
• W1973417881 hasConcept C2522874641 @default.
• W1973417881 hasConcept C2776408679 @default.
• W1973417881 hasConcept C2781463415 @default.
• W1973417881 hasConcept C2992769111 @default.
• W1973417881 hasConcept C41008148 @default.
• W1973417881 hasConcept C54355233 @default.
• W1973417881 hasConcept C70721500 @default.
• W1973417881 hasConcept C76155785 @default.
• W1973417881 hasConcept C86803240 @default.
• W1973417881 hasConceptScore W1973417881C104317684 @default.
• W1973417881 hasConceptScore W1973417881C135763542 @default.
• W1973417881 hasConceptScore W1973417881C159047783 @default.
• W1973417881 hasConceptScore W1973417881C2164484 @default.
• W1973417881 hasConceptScore W1973417881C2522874641 @default.
• W1973417881 hasConceptScore W1973417881C2776408679 @default.
• W1973417881 hasConceptScore W1973417881C2781463415 @default.
• W1973417881 hasConceptScore W1973417881C2992769111 @default.
• W1973417881 hasConceptScore W1973417881C41008148 @default.
• W1973417881 hasConceptScore W1973417881C54355233 @default.
• W1973417881 hasConceptScore W1973417881C70721500 @default.
• W1973417881 hasConceptScore W1973417881C76155785 @default.
• W1973417881 hasConceptScore W1973417881C86803240 @default.
• W1973417881 hasIssue "46" @default.
• W1973417881 hasLocation W19734178811 @default.
• W1973417881 hasOpenAccess W1973417881 @default.
• W1973417881 hasPrimaryLocation W19734178811 @default.
• W1973417881 hasRelatedWork W2008024230 @default.
• W1973417881 hasRelatedWork W2034793309 @default.
• W1973417881 hasRelatedWork W2059010078 @default.
• W1973417881 hasRelatedWork W2068259734 @default.
• W1973417881 hasRelatedWork W2072233926 @default.
• W1973417881 hasRelatedWork W2105597814 @default.
• W1973417881 hasRelatedWork W2121887853 @default.
• W1973417881 hasRelatedWork W2153196018 @default.
• W1973417881 hasRelatedWork W2357959713 @default.

• next