FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W1985482184> ?p ?o ?g. }

• W1985482184 endingPage "1031" @default.
• W1985482184 startingPage "1031" @default.
• W1985482184 abstract "Case Studies1 November 1966On the Origin of AmyloidStudy of an Amyloid Tumor in Multiple MyelomaJOSEPH GAFNI, M.D., HANS-JOACHIM MERKER, M.D., SHLOMO SHIBOLET, M.D., EZRA SOHAR, M.D., HARRY HELLER, M.D.JOSEPH GAFNI, M.D.Search for more papers by this author, HANS-JOACHIM MERKER, M.D.Search for more papers by this author, SHLOMO SHIBOLET, M.D.Search for more papers by this author, EZRA SOHAR, M.D.Search for more papers by this author, HARRY HELLER, M.D.Search for more papers by this authorAuthor, Article, and Disclosure Informationhttps://doi.org/10.7326/0003-4819-65-5-1031 SectionsAboutPDF ToolsAdd to favoritesDownload CitationsTrack CitationsPermissions ShareFacebookTwitterLinkedInRedditEmail ExcerptAlmost since the discovery of amyloid there has been much speculation as to the mode and site of its formation. Its common association with protracted inflammatory diseases and multiple myeloma implicated the production, presumably by plasma cells, of a soluble abnormal protein that was carried by the circulation to the site of its precipitation by immune mechanisms in the connective tissue ground substance (1-4). The finding of plasma cell infiltrates in meticulously re-examined cases of primary amyloidosis added weight to this theory (5, 6). In recent years, however, the local deposition of such a distantly produced precursor has been denied...References1. JUERGENS R: Eine neue Reaktion auf Amyloidkoerper. Arch. Path. Anat. 65: 189, 1875. CrossrefGoogle Scholar2. APITZ K: Die Paraproteinosen (ueber die Stoerung des Eiweisstoffwechsels beim Plasmacytom). Arch. Path. Anat. 306: 1631, 1940. Google Scholar3. VASQUEZDIXON JJFJ: Immunohistochemical analysis of amyloid by the fluorescence technique. J. Exp. Med. 104: 727, 1956. CrossrefMedlineGoogle Scholar4. OSSERMAN EF: Amyloidosis: tissue proteinosis: gammaloidosis. Ann. Intern. Med. 55: 1033, 1961. LinkGoogle Scholar5. OSSERMAN EF: Plasma-cell myeloma. New Eng. J. Med. 261: 952, 1006, 1959. CrossrefMedlineGoogle Scholar6. KYLEBAYRD RRED: Primary systemic amyloidosis and myeloma. Discussion of relationship and review of 81 cases. Arch. Intern. Med. (Chicago) 107: 344, 1961. CrossrefMedlineGoogle Scholar7. CALKINSCOHENGITLIN EASD: Immunochemical determinations of gamma-globulin content of amyloid. Fed. Proc. 17: 1693, 1958. Google Scholar8. COHENPAUL ASWE: Relationship of gamma-globulin to the fibrils of secondary human amyloid. Nature (London) 197: 193, 1963. CrossrefMedlineGoogle Scholar9. BENDITTLAGUNOFFERIKSENISERI EPDNOA: Amyloid. Extraction and preliminary characterization of some proteins. Arch. Path. (Chicago) 74: 323, 1962. MedlineGoogle Scholar10. BENDITTLAGUNOFFERIKSENISERI EPDNOA: On the nature of amyloid (abstract). Program of the American Association of Pathology and Bacteriology, May 1962, p. 36. Google Scholar11. KENNEDY JS: Sulfur-35 in experimental amyloidosis. J. Path. Bact. 83: 165, 1962. CrossrefMedlineGoogle Scholar12. TEILUM G: PAS-positive reticuloendothelial cells producing amyloid. Amer. J. Path. 32: 945, 1956. MedlineGoogle Scholar13. TEILUM G: Pathogenesis of amyloidosis in the light of recent cystochemical investigations. Acta Rheum. Scand. 3: 164, 1957. CrossrefMedlineGoogle Scholar14. COHENGROSSSHIRAHAMA ASET: The light and electron microscopic autoradiographic demonstration of local amyloid formation in spleen explants. Amer. J. Path. 47: 1079, 1965. MedlineGoogle Scholar15. GAFNISOHARHELLER JEH: The inherited amyloidoses: their clinical and theoretical significance. Lancet 1: 71, 1964. CrossrefMedlineGoogle Scholar16. TALLAUFERZLOTNICK CAA: Experimental amyloidosis in mice: a patho-serological study. Brit. J. Exp. Path. 45: 323, 1964. MedlineGoogle Scholar17. CHRISTENSENRASK-NIELSEN HER: Comparative morphologic, histochemical, and serologic studies on the pathogenesis of casein-induced and reticulosarcoma-induced amyloidosis in mice. J. Nat. Cancer Inst. 28: 1, 1962. Google Scholar18. SHIMAMURASORENSON TGD: Experimental amyloidosis. V. Relationship between experimental glomerular amyloid and the mesangial region. Amer. J. Path. 46: 645, 1965. MedlineGoogle Scholar19. GUEFTGHIDONI BJJ: The site of formation and ultrastructure of amyloid. Amer. J. Path. 43: 837, 1963. MedlineGoogle Scholar20. HASHIMOTOGROSSLEVER KBGWF: Lichen amyloidosus, histochemical and electron microscopic studies. J. Invest. Derm. 45: 204, 1965. CrossrefMedlineGoogle Scholar21. HELLERGAFNISOHAR HJE: The inherited systemic amyloidoses, in The Metabolic Basis of Inherited Disease, 2nd ed., edited by STANBURY, J. B., WYNGAARDEN, J. B., FREDRICKSON, D. S. McGraw-Hill Book Co., New York, 1966, p. 995. Google Scholar22. SMITH I: Chromatographic and Electrophoretic Techniques. Wm. Heinemann Medical Books Ltd. & Interscience Publishers, New York, 1960. Google Scholar23. HELLERMISSMAHLSOHARGAFNI HHPEJ: Amyloidosis: its differentiation into peri-reticulin and peri-collagen types. J. Path. Bact. 88: 15, 1964. CrossrefMedlineGoogle Scholar24. LETTERERCAESARVOGT ERA: Studien zur elektronenmikroskopischen und immuno-morphologischen Struktur des Amyloids. Deutsch. Med. Wschr. 85: 1909, 1960. CrossrefMedlineGoogle Scholar25. LETTERER E: Morphologische Folgen der Antigen-Antikoerper Reaktion. Verh. Deutsch. Ges. Path. 46: 83, 1962. MedlineGoogle Scholar26. CATHCARTCOHEN ESAS: The relation between isolated human amyloid fibrils and human gamma-globulin and its subunits. J. Immun. 96: 239, 1966. MedlineGoogle Scholar27. TEILUM G: Pathogenesis of amyloidosis: the two-phase cellular theory of local secretion. Acta Path. Microbiol. Scand. 61: 21, 1964. CrossrefMedlineGoogle Scholar28. COHENGROSSSHIRAHAMA ASET: The light and electron microscopic autoradiographic demonstration of local amyloid formation in spleen explants. Amer. J. Path. 47: 1079, 1965. MedlineGoogle Scholar29. SCHWARZ W: Fibrillogenese und Bildung der elastischen Fasern. Arch. Biol. (Liege) 75: 369, 1964. MedlineGoogle Scholar30. MOVATFERNANDO HZNV: The fine structure of connective tissue. I. The fibroblast. Exp. Molec. Path. 1: 509, 1962. CrossrefMedlineGoogle Scholar31. ROSSBENDITT REP: Wound healing and collagen formation. III. A quantitative radioautographic study of the utilization of proline-H3 in wounds from normal and scorbutic guinea pigs. J. Cell Biol. 15: 99, 1962. CrossrefMedlineGoogle Scholar32. GOLDBERGGREEN BH: An analysis of collagen secretion by established mouse fibroblast lines. J. Cell Biol. 22: 227, 1964. CrossrefMedlineGoogle Scholar33. WOHLFARTH-BOTTERMANN KE: Differentiation of the ground cytoplasm and their significance for the generation of the motive force of ameboid movement, in Primitive Motile Systems in Cell Biology, edited by ALLEN, R. D., KAMIYA, N. Academic Press, New York, 1964, pp. 79-109. CrossrefGoogle Scholar34. DICKLEITER GFL: Some factors in the development, localization and reabsorption of experimental amyloidosis in rabbits. Amer. J. Path. 17: 74, 1941. Google Scholar35. COHENCALKINS ASE: Electron microscopic observations on a fibrous component in amyloid of diverse origins. Nature (London) 183: 1202, 1959. CrossrefMedlineGoogle Scholar36. BOERERUINENSCHOLTEN HLJH: Electron microscopic studies on the fibrillar component of human splenic amyloid. J. Lab. Clin. Med. 66: 943, 1965. MedlineGoogle Scholar37. SHIRAHAMACOHEN TAS: Structure of amyloid fibrils after negative staining and high-resolution electron microscopy. Nature (London) 206: 737, 1965. CrossrefMedlineGoogle Scholar38. MERKERSHIBOLETSOHARGAFNIHELLER HJSEJH: Periodic cross-banding in amyloid filaments. Nature (London) 211: 1401, 1966. CrossrefMedlineGoogle Scholar39. HODGE AJ: Principles of ordering in fibrous systems, in Proceedings of the 4th International Congress of Electron Microscopy (Berlin, 1958). Springer, 1960, pp. 119-139. Google Scholar40. GROSS J: The behavior of collagen units as a model in morphogenesis. J. Biophys. Biochem. Cytol. 2 (suppl.): 261, 1956. CrossrefMedlineGoogle Scholar41. GAFNISOHARKARIVSHERFPRASSHELLERMANIMISSMAHLFRENSDORFFSHIBOLETBLUM JEILMHAHPASA: Milestones in the concept of familial Mediterranean fever. Proc. Tel Hashomer Hosp. 3: 13, 1964. Google Scholar42. SOHAR E: The genetic amyloidoses with special emphasis on familial Mediterranean fever. Henry Ford Hosp. Med. Bull. 12: 343, 1964. Google Scholar43. HASHIMOTO K: Personal communication, 1966. Google Scholar44. WOLFF J: Elektronenmikroskopische Untersuchungen ueber die Altersveraenderungen am Interstitiellen Bindegewebe des menschlichen Herzens. Z. Rheumaforsch 20: 175, 1961. MedlineGoogle Scholar This content is PDF only. To continue reading please click on the PDF icon. Author, Article, and Disclosure InformationAffiliations: Tel-Aviv,From the Departments of Medicine and Clinical Investigation, Tel-Aviv University Medical School and Tel-Hashomer Hospital, Tel-Aviv, Israel.This study was supported in part by research grant AM-09272, National Institutes of Health, Bethesda, Md.Requests for reprints should be addressed to Joseph Gafni, M.D., Tel-Hashomer Hospital, Tel-Aviv, Israel. PreviousarticleNextarticle Advertisement FiguresReferencesRelatedDetails Metrics Cited byBinding of nascent collagen by amyloidogenic light chains and amyloid fibrillogenesis in monolayers of human fibrocytesA Brief Review of the Ultrastructure of AmyloidPATHOLOGICAL STUDY ON AMYLOIDOSISHistochemical investigation of acid mucopolysaccharides in amyloid, colloid and hyalineTHE FINE STRUCTURE OF GLOMERULAR EPITHELIAL CELLS IN EXPERIMENTAL RENAL AMYLOIDOSISElektronenmikroskopische Befunde bei der sog. membranoproliferativen GlomerulonephritisElektronenmikroskopische Untersuchungen über die Amyloidose der Atrioventrikularklappen des HundesParaproteinämische HämoblastosenAmyloidosis and multiple myelomaFAMILIAL LICHEN AMYLOIDOSIS.Amyloidose der Herzklappen beim HundZur Pathogenese der senilen AmyloidoseLICHEN AMYLOIDOSIS.Diffuse alveolarseptale LungenamyloidoseAblagerungsdermatosen; Amyloidablagerungen in der HautAmyloid-bearing tumors of micePrimary amyloidosisPerikollagene Amyloidablagerungen in Haut und inneren Organen bei SklerodermiePrimary AmyloidosisWERNER F. BARTH, M.D., GEORGE G. GLENNER, M.D., THOMAS A. WALDMANN, M.D., ROBERT F. ZELIS, M.D.Primary amyloidosis with “monoclonal” immunoglobulin A proteinemiaDys- und Paraproteinämien bei AmyloidbefallAmyloidosis and the gutAmyloidosen bei chronisch-rheumatischen ErkrankungenColloid Milium: A Histochemical Study*Familial Mediterranean feverElectron-microscope observations on peri-reticulin and peri-collagen amyloidosis in rectal biopsiesElectron Microscope Observations of the Fine Structure of Microsporum Gypseum**From the Department of Zoology, Louisiana State University, Baton Rouge, Louisiana. 1 November 1966Volume 65, Issue 5Page: 1031-1044KeywordsAmyloidosisConnective tissue diseasesElectron microscopyHospital medicineImmunoprecipitationMultiple myelomaPlasma cellsPlasma proteinsResearch grantsSurgeons Issue Published: 1 November 1966 PDF downloadLoading ..." @default.
• W1985482184 created "2016-06-24" @default.
• W1985482184 creator A5018872927 @default.
• W1985482184 creator A5026735023 @default.
• W1985482184 creator A5054088147 @default.
• W1985482184 creator A5057454422 @default.
• W1985482184 creator A5069402779 @default.
• W1985482184 date "1966-11-01" @default.
• W1985482184 modified "2023-09-23" @default.
• W1985482184 title "On the Origin of Amyloid" @default.
• W1985482184 cites W1485372474 @default.
• W1985482184 cites W1581831308 @default.
• W1985482184 cites W1601049602 @default.
• W1985482184 cites W1972603199 @default.
• W1985482184 cites W1982893653 @default.
• W1985482184 cites W1984474730 @default.
• W1985482184 cites W2041430401 @default.
• W1985482184 cites W2046576999 @default.
• W1985482184 cites W2053177646 @default.
• W1985482184 cites W2058758839 @default.
• W1985482184 cites W2065931823 @default.
• W1985482184 cites W2066522430 @default.
• W1985482184 cites W2082612406 @default.
• W1985482184 cites W2106005634 @default.
• W1985482184 cites W2111041313 @default.
• W1985482184 cites W2124374162 @default.
• W1985482184 cites W2125175063 @default.
• W1985482184 cites W2137048578 @default.
• W1985482184 cites W2166435721 @default.
• W1985482184 cites W2210085899 @default.
• W1985482184 cites W2260876874 @default.
• W1985482184 cites W2301398001 @default.
• W1985482184 cites W2368951300 @default.
• W1985482184 cites W2412548711 @default.
• W1985482184 cites W2439493462 @default.
• W1985482184 cites W2460780006 @default.
• W1985482184 cites W2470389680 @default.
• W1985482184 cites W2488344555 @default.
• W1985482184 cites W2959646326 @default.
• W1985482184 cites W30932420 @default.
• W1985482184 doi "https://doi.org/10.7326/0003-4819-65-5-1031" @default.
• W1985482184 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/5923085" @default.
• W1985482184 hasPublicationYear "1966" @default.
• W1985482184 type Work @default.
• W1985482184 sameAs 1985482184 @default.
• W1985482184 citedByCount "35" @default.
• W1985482184 crossrefType "journal-article" @default.
• W1985482184 hasAuthorship W1985482184A5018872927 @default.
• W1985482184 hasAuthorship W1985482184A5026735023 @default.
• W1985482184 hasAuthorship W1985482184A5054088147 @default.
• W1985482184 hasAuthorship W1985482184A5057454422 @default.
• W1985482184 hasAuthorship W1985482184A5069402779 @default.
• W1985482184 hasConcept C142724271 @default.
• W1985482184 hasConcept C2777633098 @default.
• W1985482184 hasConcept C2779951007 @default.
• W1985482184 hasConcept C71924100 @default.
• W1985482184 hasConceptScore W1985482184C142724271 @default.
• W1985482184 hasConceptScore W1985482184C2777633098 @default.
• W1985482184 hasConceptScore W1985482184C2779951007 @default.
• W1985482184 hasConceptScore W1985482184C71924100 @default.
• W1985482184 hasIssue "5" @default.
• W1985482184 hasLocation W19854821841 @default.
• W1985482184 hasLocation W19854821842 @default.
• W1985482184 hasOpenAccess W1985482184 @default.
• W1985482184 hasPrimaryLocation W19854821841 @default.
• W1985482184 hasRelatedWork W1504170807 @default.
• W1985482184 hasRelatedWork W175787708 @default.
• W1985482184 hasRelatedWork W1973391728 @default.
• W1985482184 hasRelatedWork W2024812753 @default.
• W1985482184 hasRelatedWork W2025519321 @default.
• W1985482184 hasRelatedWork W2060301619 @default.
• W1985482184 hasRelatedWork W2398160926 @default.
• W1985482184 hasRelatedWork W2529581379 @default.
• W1985482184 hasRelatedWork W3015231472 @default.
• W1985482184 hasRelatedWork W77766591 @default.
• W1985482184 hasVolume "65" @default.
• W1985482184 isParatext "false" @default.
• W1985482184 isRetracted "false" @default.
• W1985482184 magId "1985482184" @default.
• W1985482184 workType "article" @default.