Matches in SemOpenAlex for { <https://semopenalex.org/work/W1991292007> ?p ?o ?g. }
Showing items 1 to 71 of
71
with 100 items per page.
- W1991292007 endingPage "315" @default.
- W1991292007 startingPage "315" @default.
- W1991292007 abstract "Letters and Corrections1 February 1984Ranitidine and Acetaminophen HepatotoxicityK.V. SPEEG JR., M.D., PH.D., D.C. CHRISTIAN, M.D., M.C. MITCHELL, M.D.K.V. SPEEG JR., M.D., PH.D.Search for more papers by this author, D.C. CHRISTIAN, M.D.Search for more papers by this author, M.C. MITCHELL, M.D.Search for more papers by this authorAuthor, Article, and Disclosure Informationhttps://doi.org/10.7326/0003-4819-100-2-315_2 SectionsAboutPDF ToolsAdd to favoritesDownload CitationsTrack CitationsPermissions ShareFacebookTwitterLinkedInRedditEmail ExcerptTo the editor: We read with interest the recent editorial (1) comparing ranitidine and cimetidine. We agree that ranitidine will acquire its own profile of adverse effects but think the effect of ranitidine on cytochrome P-450 activity can be clarified.Ranitidine binds to cytochrome P-450 and if present in sufficient concentration would be expected to inhibit oxidation of other drugs by this microsomal enzyme system (2, 3). Ranitidine is much less potent as an inhibitor of cytochrome P-450 than cimetidine in all systems tested. The inhibition by ranitidine of acetaminophen metabolism cited in the editorial requires comment because this observation...References1. MCCARTHY D. Ranitidine or cimetidine [Editorial]. Ann Intern Med. 1983;99:551-3. LinkGoogle Scholar2. SPEEGPATWARDHANAVANTMITCHELLSCHENKER KRGMS. Inhibition of microsomal drug metabolism by histamine H2-receptor antagonists studied in vivo and in vitro in rodents. Gastroenterology. 1982;82:89-96. CrossrefMedlineGoogle Scholar3. RENDICALEBIC-KOLBAHKAJFEZRUF STFH. Interaction of ranitidine with liver microsomes. Xenobiotica. 1982;12:9-17. CrossrefMedlineGoogle Scholar4. BOYD M. Toxicity mediated by reactive metabolites of furans. Adv Exp Med Biol. 1980;136B:865-79. Google Scholar5. MITCHELLSCHENKERAVANTSPEEG MSGK. Cimetidine protects against acetaminophen hepatotoxicity in rats. Gastroenterology. 1981;81:1052-60. CrossrefMedlineGoogle Scholar6. MITCHELLSCHENKERSPEEG MSK. Selective inhibition of acetaminophen oxidation and toxicity by cimetidine and other H2-receptor antagonists in vivo and in vitro in the rat and in man. J Clin Invest. 1984. (In press). CrossrefGoogle Scholar This content is PDF only. To continue reading please click on the PDF icon. Author, Article, and Disclosure InformationAuthors: K.V. SPEEGJR., M.D., PH.D.; D.C. CHRISTIAN, M.D.; M.C. MITCHELL, M.D.Affiliations: PreviousarticleNextarticle Advertisement FiguresReferencesRelatedDetails Metrics Cited byUn anti-acide en prévention du syndrome de Mendelson : oui mais lequel ?Effect of ranitidine on acetaminophen-induced hepatotoxicity in dogsRanitidine drug interactions—a literature reviewRANITIDINE AND PARACETAMOL METABOLISMH2 Receptor Antagonists, Cytochrome P450, and Paracetamol-induced HepatotoxicityRanitidine and the LiverMARCOS A. SOUZA LIMA, M.D.Ranitidine, Acetaminophen, and HepatotoxicityJAMES E. BREDFELDT, M.D., CHRISTIAN VON HUENE, M.D. 1 February 1984Volume 100, Issue 2Page: 315-316KeywordsAttentionDrugsEnzymes ePublished: 1 December 2008 Issue Published: 1 February 1984 PDF downloadLoading ..." @default.
- W1991292007 created "2016-06-24" @default.
- W1991292007 creator A5034740450 @default.
- W1991292007 date "1984-02-01" @default.
- W1991292007 modified "2023-09-25" @default.
- W1991292007 title "Ranitidine and Acetaminophen Hepatotoxicity" @default.
- W1991292007 cites W1516855358 @default.
- W1991292007 cites W1936243553 @default.
- W1991292007 cites W1972269499 @default.
- W1991292007 cites W2106275300 @default.
- W1991292007 cites W2428945038 @default.
- W1991292007 doi "https://doi.org/10.7326/0003-4819-100-2-315_2" @default.
- W1991292007 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/6318636" @default.
- W1991292007 hasPublicationYear "1984" @default.
- W1991292007 type Work @default.
- W1991292007 sameAs 1991292007 @default.
- W1991292007 citedByCount "7" @default.
- W1991292007 crossrefType "journal-article" @default.
- W1991292007 hasAuthorship W1991292007A5034740450 @default.
- W1991292007 hasConcept C1122143 @default.
- W1991292007 hasConcept C126322002 @default.
- W1991292007 hasConcept C185592680 @default.
- W1991292007 hasConcept C202751555 @default.
- W1991292007 hasConcept C2777445857 @default.
- W1991292007 hasConcept C2778722691 @default.
- W1991292007 hasConcept C2780035454 @default.
- W1991292007 hasConcept C2780719153 @default.
- W1991292007 hasConcept C526171541 @default.
- W1991292007 hasConcept C55493867 @default.
- W1991292007 hasConcept C62231903 @default.
- W1991292007 hasConcept C71924100 @default.
- W1991292007 hasConcept C87644729 @default.
- W1991292007 hasConcept C97320921 @default.
- W1991292007 hasConcept C98274493 @default.
- W1991292007 hasConceptScore W1991292007C1122143 @default.
- W1991292007 hasConceptScore W1991292007C126322002 @default.
- W1991292007 hasConceptScore W1991292007C185592680 @default.
- W1991292007 hasConceptScore W1991292007C202751555 @default.
- W1991292007 hasConceptScore W1991292007C2777445857 @default.
- W1991292007 hasConceptScore W1991292007C2778722691 @default.
- W1991292007 hasConceptScore W1991292007C2780035454 @default.
- W1991292007 hasConceptScore W1991292007C2780719153 @default.
- W1991292007 hasConceptScore W1991292007C526171541 @default.
- W1991292007 hasConceptScore W1991292007C55493867 @default.
- W1991292007 hasConceptScore W1991292007C62231903 @default.
- W1991292007 hasConceptScore W1991292007C71924100 @default.
- W1991292007 hasConceptScore W1991292007C87644729 @default.
- W1991292007 hasConceptScore W1991292007C97320921 @default.
- W1991292007 hasConceptScore W1991292007C98274493 @default.
- W1991292007 hasIssue "2" @default.
- W1991292007 hasLocation W19912920071 @default.
- W1991292007 hasLocation W19912920072 @default.
- W1991292007 hasOpenAccess W1991292007 @default.
- W1991292007 hasPrimaryLocation W19912920071 @default.
- W1991292007 hasRelatedWork W1240188821 @default.
- W1991292007 hasRelatedWork W1821512831 @default.
- W1991292007 hasRelatedWork W1939554960 @default.
- W1991292007 hasRelatedWork W1981738430 @default.
- W1991292007 hasRelatedWork W2007609998 @default.
- W1991292007 hasRelatedWork W2063576974 @default.
- W1991292007 hasRelatedWork W2070595669 @default.
- W1991292007 hasRelatedWork W2077306179 @default.
- W1991292007 hasRelatedWork W2397454001 @default.
- W1991292007 hasRelatedWork W299766063 @default.
- W1991292007 hasVolume "100" @default.
- W1991292007 isParatext "false" @default.
- W1991292007 isRetracted "false" @default.
- W1991292007 magId "1991292007" @default.
- W1991292007 workType "article" @default.