FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W1991999062> ?p ?o ?g. }

• W1991999062 endingPage "e70108" @default.
• W1991999062 startingPage "e70108" @default.
• W1991999062 abstract "Cell penetrating peptides (CPPs) are actively researched as non-viral molecular carriers for the controlled delivery of nucleic acids into cells, but widespread application is severely hampered by their trapping into endosomes. Here we show that the recently introduced endosomolytic CM18-Tat11 hybrid peptide (KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR, residues 1-7 of Cecropin-A, 2-12 of Melittin, and 47-57 of HIV-1 Tat protein) can be exploited to obtain a self-assembled peptide-DNA vector which maintains the CM18-Tat11 ability to enter cells and destabilize vesicular membranes, concomitantly yielding high DNA transfection efficiency with no detectable cytotoxic effects. Different peptide-DNA stoichiometric ratios were tested to optimize vector size, charge, and stability characteristics. The transfection efficiency of selected candidates is quantitatively investigated by the luciferase-reporter assay. Vector intracellular trafficking is monitored in real time and in live cells by confocal microscopy. In particular, fluorescence resonant energy transfer (FRET) between suitably-labeled peptide and DNA modules was exploited to monitor complex disassembly during endocytosis, and this process is correlated to transfection timing and efficiency. We argue that these results can open the way to the rational design and application of CM18-Tat11–based systems for gene-delivery purposes." @default.
• W1991999062 created "2016-06-24" @default.
• W1991999062 creator A5010966028 @default.
• W1991999062 creator A5023888462 @default.
• W1991999062 creator A5033342633 @default.
• W1991999062 creator A5039230712 @default.
• W1991999062 creator A5073809598 @default.
• W1991999062 date "2013-07-29" @default.
• W1991999062 modified "2023-09-23" @default.
• W1991999062 title "In Vitro Efficient Transfection by CM18-Tat11 Hybrid Peptide: A New Tool for Gene-Delivery Applications" @default.
• W1991999062 cites W144183931 @default.
• W1991999062 cites W1481565655 @default.
• W1991999062 cites W1490477754 @default.
• W1991999062 cites W1520821663 @default.
• W1991999062 cites W1965340954 @default.
• W1991999062 cites W1972183902 @default.
• W1991999062 cites W1973911001 @default.
• W1991999062 cites W1975088956 @default.
• W1991999062 cites W1975541922 @default.
• W1991999062 cites W1980338435 @default.
• W1991999062 cites W1984679573 @default.
• W1991999062 cites W1986857004 @default.
• W1991999062 cites W1995198555 @default.
• W1991999062 cites W1998113813 @default.
• W1991999062 cites W2001239208 @default.
• W1991999062 cites W2001986771 @default.
• W1991999062 cites W2003414091 @default.
• W1991999062 cites W2014356856 @default.
• W1991999062 cites W2015338160 @default.
• W1991999062 cites W2027022352 @default.
• W1991999062 cites W2027587162 @default.
• W1991999062 cites W2029697829 @default.
• W1991999062 cites W2037895830 @default.
• W1991999062 cites W2041922085 @default.
• W1991999062 cites W2049109647 @default.
• W1991999062 cites W2052530916 @default.
• W1991999062 cites W2064633836 @default.
• W1991999062 cites W2071286357 @default.
• W1991999062 cites W2075634764 @default.
• W1991999062 cites W2081712965 @default.
• W1991999062 cites W2086274688 @default.
• W1991999062 cites W2087893222 @default.
• W1991999062 cites W2090214004 @default.
• W1991999062 cites W2092726726 @default.
• W1991999062 cites W2123650819 @default.
• W1991999062 cites W2139763819 @default.
• W1991999062 cites W2141506589 @default.
• W1991999062 cites W2151163354 @default.
• W1991999062 cites W2325089333 @default.
• W1991999062 cites W45084834 @default.
• W1991999062 doi "https://doi.org/10.1371/journal.pone.0070108" @default.
• W1991999062 hasPubMedCentralId "https://www.ncbi.nlm.nih.gov/pmc/articles/3726494" @default.
• W1991999062 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/23922923" @default.
• W1991999062 hasPublicationYear "2013" @default.
• W1991999062 type Work @default.
• W1991999062 sameAs 1991999062 @default.
• W1991999062 citedByCount "25" @default.
• W1991999062 countsByYear W19919990622014 @default.
• W1991999062 countsByYear W19919990622015 @default.
• W1991999062 countsByYear W19919990622017 @default.
• W1991999062 countsByYear W19919990622018 @default.
• W1991999062 countsByYear W19919990622019 @default.
• W1991999062 countsByYear W19919990622021 @default.
• W1991999062 countsByYear W19919990622022 @default.
• W1991999062 countsByYear W19919990622023 @default.
• W1991999062 crossrefType "journal-article" @default.
• W1991999062 hasAuthorship W1991999062A5010966028 @default.
• W1991999062 hasAuthorship W1991999062A5023888462 @default.
• W1991999062 hasAuthorship W1991999062A5033342633 @default.
• W1991999062 hasAuthorship W1991999062A5039230712 @default.
• W1991999062 hasAuthorship W1991999062A5073809598 @default.
• W1991999062 hasBestOaLocation W19919990621 @default.
• W1991999062 hasConcept C102747710 @default.
• W1991999062 hasConcept C104317684 @default.
• W1991999062 hasConcept C121332964 @default.
• W1991999062 hasConcept C12554922 @default.
• W1991999062 hasConcept C135983454 @default.
• W1991999062 hasConcept C150194340 @default.
• W1991999062 hasConcept C153911025 @default.
• W1991999062 hasConcept C161733203 @default.
• W1991999062 hasConcept C24107716 @default.
• W1991999062 hasConcept C2776929087 @default.
• W1991999062 hasConcept C2779281246 @default.
• W1991999062 hasConcept C54009773 @default.
• W1991999062 hasConcept C55493867 @default.
• W1991999062 hasConcept C62520636 @default.
• W1991999062 hasConcept C79879829 @default.
• W1991999062 hasConcept C86803240 @default.
• W1991999062 hasConcept C91881484 @default.
• W1991999062 hasConcept C95444343 @default.
• W1991999062 hasConcept C96305047 @default.
• W1991999062 hasConceptScore W1991999062C102747710 @default.
• W1991999062 hasConceptScore W1991999062C104317684 @default.
• W1991999062 hasConceptScore W1991999062C121332964 @default.
• W1991999062 hasConceptScore W1991999062C12554922 @default.
• W1991999062 hasConceptScore W1991999062C135983454 @default.
• W1991999062 hasConceptScore W1991999062C150194340 @default.
• W1991999062 hasConceptScore W1991999062C153911025 @default.

• next