FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W1999855229> ?p ?o ?g. }

• W1999855229 endingPage "140" @default.
• W1999855229 startingPage "129" @default.
• W1999855229 abstract "Isolated stem cells from the midguts of Manduca sexta and Heliothis virescens can be induced to differentiate in vitro by either of two polypeptide factors. One of the peptides was isolated from culture medium conditioned by differentiating mixed midgut cells; we used high performance liquid chromatographic separation and Edman degradation of the most prominent active peak. It is a polypeptide with 30 amino acid residues (3,244 Da), with the sequence HVGKTPIVGQPSIPGGPVRLCPGRIRYFKI, and is identical to the C-terminal peptide of bovine fetuin. A portion of this molecule (HVGKTPIVGQPSIPGGPVRLCPGRIR) was synthesized and was found to be very active in inducing differentiation of H. Virescens midgut stem cells. It was designated Midgut Differentiation Factor 1 (MDF1). Proteolysis of bovine fetuin with chymotrypsin allowed isolation of a pentamer, Midgut Differentiation Factor 2 (MDF2) with the sequence HRAHY corresponding to a portion of the fetuin molecule near MDF1. Synthetic MDF2 was also biologically active in midgut stem cell bioassays. Dose response curves indicate activity in physiological ranges from 10–14 to 10–9 M for MDF1 and 10–15 to 10–5 M for MDF2. Arch. Insect Biochem. Physiol. 40:129–140, 1999. Published 1999 Wiley-Liss, Inc. This article is a US Government work and, as such, is in the public domain in the United States of America." @default.
• W1999855229 created "2016-06-24" @default.
• W1999855229 creator A5023248731 @default.
• W1999855229 creator A5031177742 @default.
• W1999855229 creator A5032684276 @default.
• W1999855229 creator A5084090331 @default.
• W1999855229 date "1999-01-01" @default.
• W1999855229 modified "2023-09-27" @default.
• W1999855229 title "Two polypeptide factors that promote differentiation of insect midgut stem cells in vitro" @default.
• W1999855229 cites W1798123912 @default.
• W1999855229 cites W1913731858 @default.
• W1999855229 cites W1970395009 @default.
• W1999855229 cites W1973050753 @default.
• W1999855229 cites W1974553453 @default.
• W1999855229 cites W1975015705 @default.
• W1999855229 cites W1977489127 @default.
• W1999855229 cites W1985020835 @default.
• W1999855229 cites W1985308591 @default.
• W1999855229 cites W1991195894 @default.
• W1999855229 cites W2010550147 @default.
• W1999855229 cites W2013124188 @default.
• W1999855229 cites W2017779705 @default.
• W1999855229 cites W2022128375 @default.
• W1999855229 cites W2022924007 @default.
• W1999855229 cites W2025863678 @default.
• W1999855229 cites W2036447374 @default.
• W1999855229 cites W2037274675 @default.
• W1999855229 cites W2038622520 @default.
• W1999855229 cites W2039815807 @default.
• W1999855229 cites W2041014095 @default.
• W1999855229 cites W2048695716 @default.
• W1999855229 cites W2057600332 @default.
• W1999855229 cites W2060263707 @default.
• W1999855229 cites W2073567028 @default.
• W1999855229 cites W2081120362 @default.
• W1999855229 cites W2081689397 @default.
• W1999855229 cites W2120097537 @default.
• W1999855229 cites W2143275370 @default.
• W1999855229 cites W2145248956 @default.
• W1999855229 cites W2237697673 @default.
• W1999855229 cites W2338534398 @default.
• W1999855229 cites W2897502336 @default.
• W1999855229 cites W4211013408 @default.
• W1999855229 cites W4242493778 @default.
• W1999855229 cites W4250500183 @default.
• W1999855229 cites W4254342999 @default.
• W1999855229 doi "https://doi.org/10.1002/(sici)1520-6327(1999)40:3<129::aid-arch2>3.0.co;2-b" @default.
• W1999855229 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/10207992" @default.
• W1999855229 hasPublicationYear "1999" @default.
• W1999855229 type Work @default.
• W1999855229 sameAs 1999855229 @default.
• W1999855229 citedByCount "39" @default.
• W1999855229 countsByYear W19998552292015 @default.
• W1999855229 countsByYear W19998552292016 @default.
• W1999855229 countsByYear W19998552292017 @default.
• W1999855229 countsByYear W19998552292019 @default.
• W1999855229 crossrefType "journal-article" @default.
• W1999855229 hasAuthorship W1999855229A5023248731 @default.
• W1999855229 hasAuthorship W1999855229A5031177742 @default.
• W1999855229 hasAuthorship W1999855229A5032684276 @default.
• W1999855229 hasAuthorship W1999855229A5084090331 @default.
• W1999855229 hasConcept C104317684 @default.
• W1999855229 hasConcept C108625454 @default.
• W1999855229 hasConcept C150149183 @default.
• W1999855229 hasConcept C153911025 @default.
• W1999855229 hasConcept C167625842 @default.
• W1999855229 hasConcept C173758957 @default.
• W1999855229 hasConcept C202751555 @default.
• W1999855229 hasConcept C2777612826 @default.
• W1999855229 hasConcept C2778541144 @default.
• W1999855229 hasConcept C2780312687 @default.
• W1999855229 hasConcept C28328180 @default.
• W1999855229 hasConcept C54355233 @default.
• W1999855229 hasConcept C55493867 @default.
• W1999855229 hasConcept C59822182 @default.
• W1999855229 hasConcept C81885089 @default.
• W1999855229 hasConcept C86803240 @default.
• W1999855229 hasConcept C87933860 @default.
• W1999855229 hasConcept C95444343 @default.
• W1999855229 hasConceptScore W1999855229C104317684 @default.
• W1999855229 hasConceptScore W1999855229C108625454 @default.
• W1999855229 hasConceptScore W1999855229C150149183 @default.
• W1999855229 hasConceptScore W1999855229C153911025 @default.
• W1999855229 hasConceptScore W1999855229C167625842 @default.
• W1999855229 hasConceptScore W1999855229C173758957 @default.
• W1999855229 hasConceptScore W1999855229C202751555 @default.
• W1999855229 hasConceptScore W1999855229C2777612826 @default.
• W1999855229 hasConceptScore W1999855229C2778541144 @default.
• W1999855229 hasConceptScore W1999855229C2780312687 @default.
• W1999855229 hasConceptScore W1999855229C28328180 @default.
• W1999855229 hasConceptScore W1999855229C54355233 @default.
• W1999855229 hasConceptScore W1999855229C55493867 @default.
• W1999855229 hasConceptScore W1999855229C59822182 @default.
• W1999855229 hasConceptScore W1999855229C81885089 @default.
• W1999855229 hasConceptScore W1999855229C86803240 @default.
• W1999855229 hasConceptScore W1999855229C87933860 @default.
• W1999855229 hasConceptScore W1999855229C95444343 @default.
• W1999855229 hasIssue "3" @default.

• next