FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W2020284911> ?p ?o ?g. }

• W2020284911 endingPage "524" @default.
• W2020284911 startingPage "513" @default.
• W2020284911 abstract "A fructosyltransferase that transfers the terminal (2 --> 1)-beta-linked D-fructosyl group of fructo-oligosaccharides (1(F)(1-beta-D-fructofuranosyl)(n) sucrose, n >/= 1) to HO-6 of the glucosyl residue and HO-1 of the fructosyl residue of similar saccharides (1(F)(1-beta-D-fructofuranosyl)(m) sucrose, m >/= 0) has been purified from an extract of the bulbs of onion (Allium cepa). Successive column chromatography using DEAE-Sepharose CL-6B, Toyopearl HW65, Toyopearl HW55, DEAE-Sepharose CL-6B (2nd time), Sephadex G-100, Concanavalin A Sepharose, and Toyopearl HW-65 (2nd time) were applied for protein purification. The general properties of the enzyme, were as follows: molecular masses of 66 kDa (gel filtration chromatography), and of 52 kDa and 25 kDa (SDS-PAGE); optimum pH of c. 5.68, stable at 20-40 degrees C for 15 min; stable in a range of pH 5.30-6.31 at 30 degrees C for 30 min, inhibited by Hg(2+), Ag(+), p-chloromercuribenzoic acid (p-CMB) and sodium dodecyl sulfate (SDS), activated by sodium deoxycholate, Triton X-100 and Tween-80. The amino acid sequence of the N-terminus moiety of the 52-kDa polypeptide was ADNEFPWTNDMLAWQRCGFHFRTVRNYMNDPSGPMYYKGWYHLFYQHNKDFAYXG and the amino acid sequence from the N-terminus of the 25-kDa polypeptide was ADVGYXCSTSGGAATRGTLGPFGLL VLANQDLTENTATYFYVSKGTDGALRTHFCQDET. The enzyme tentatively classified as fructan: fructan 6(G)-fructosyltransferase (6G-FFT). The enzyme is proposed to play an important role in the synthesis of inulin and inulinneo-series fructo-oligosaccharides in onion bulbs." @default.
• W2020284911 created "2016-06-24" @default.
• W2020284911 creator A5039095558 @default.
• W2020284911 creator A5044975629 @default.
• W2020284911 creator A5048652457 @default.
• W2020284911 creator A5072909868 @default.
• W2020284911 creator A5079627883 @default.
• W2020284911 creator A5082321380 @default.
• W2020284911 creator A5091089849 @default.
• W2020284911 date "2004-11-12" @default.
• W2020284911 modified "2023-10-14" @default.
• W2020284911 title "Purification and characterization of a fructosyltransferase from onion bulbs and its key role in the synthesis of fructo‐oligosaccharides <i>in vivo</i>" @default.
• W2020284911 cites W1497245978 @default.
• W2020284911 cites W1527522123 @default.
• W2020284911 cites W1579489628 @default.
• W2020284911 cites W1974060160 @default.
• W2020284911 cites W1983865877 @default.
• W2020284911 cites W1984092785 @default.
• W2020284911 cites W1987922830 @default.
• W2020284911 cites W2000588531 @default.
• W2020284911 cites W2007647215 @default.
• W2020284911 cites W2009946555 @default.
• W2020284911 cites W2014462685 @default.
• W2020284911 cites W2030327927 @default.
• W2020284911 cites W2038664696 @default.
• W2020284911 cites W2039969070 @default.
• W2020284911 cites W2046281726 @default.
• W2020284911 cites W2050230270 @default.
• W2020284911 cites W2058498109 @default.
• W2020284911 cites W2059185472 @default.
• W2020284911 cites W2068660116 @default.
• W2020284911 cites W2074322230 @default.
• W2020284911 cites W2075412164 @default.
• W2020284911 cites W2077444393 @default.
• W2020284911 cites W2094640974 @default.
• W2020284911 cites W2099139884 @default.
• W2020284911 cites W2100837269 @default.
• W2020284911 cites W2111301002 @default.
• W2020284911 cites W2132068224 @default.
• W2020284911 cites W2136783482 @default.
• W2020284911 cites W322422874 @default.
• W2020284911 cites W4236716612 @default.
• W2020284911 cites W4253071556 @default.
• W2020284911 doi "https://doi.org/10.1111/j.1469-8137.2004.01231.x" @default.
• W2020284911 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/15720662" @default.
• W2020284911 hasPublicationYear "2004" @default.
• W2020284911 type Work @default.
• W2020284911 sameAs 2020284911 @default.
• W2020284911 citedByCount "63" @default.
• W2020284911 countsByYear W20202849112012 @default.
• W2020284911 countsByYear W20202849112013 @default.
• W2020284911 countsByYear W20202849112014 @default.
• W2020284911 countsByYear W20202849112015 @default.
• W2020284911 countsByYear W20202849112016 @default.
• W2020284911 countsByYear W20202849112017 @default.
• W2020284911 countsByYear W20202849112018 @default.
• W2020284911 countsByYear W20202849112019 @default.
• W2020284911 countsByYear W20202849112020 @default.
• W2020284911 countsByYear W20202849112021 @default.
• W2020284911 countsByYear W20202849112022 @default.
• W2020284911 countsByYear W20202849112023 @default.
• W2020284911 crossrefType "journal-article" @default.
• W2020284911 hasAuthorship W2020284911A5039095558 @default.
• W2020284911 hasAuthorship W2020284911A5044975629 @default.
• W2020284911 hasAuthorship W2020284911A5048652457 @default.
• W2020284911 hasAuthorship W2020284911A5072909868 @default.
• W2020284911 hasAuthorship W2020284911A5079627883 @default.
• W2020284911 hasAuthorship W2020284911A5082321380 @default.
• W2020284911 hasAuthorship W2020284911A5091089849 @default.
• W2020284911 hasBestOaLocation W20202849111 @default.
• W2020284911 hasConcept C163994747 @default.
• W2020284911 hasConcept C181199279 @default.
• W2020284911 hasConcept C185592680 @default.
• W2020284911 hasConcept C193363816 @default.
• W2020284911 hasConcept C2777726330 @default.
• W2020284911 hasConcept C2778597767 @default.
• W2020284911 hasConcept C2779742124 @default.
• W2020284911 hasConcept C2781338088 @default.
• W2020284911 hasConcept C43617362 @default.
• W2020284911 hasConcept C55493867 @default.
• W2020284911 hasConcept C73583747 @default.
• W2020284911 hasConceptScore W2020284911C163994747 @default.
• W2020284911 hasConceptScore W2020284911C181199279 @default.
• W2020284911 hasConceptScore W2020284911C185592680 @default.
• W2020284911 hasConceptScore W2020284911C193363816 @default.
• W2020284911 hasConceptScore W2020284911C2777726330 @default.
• W2020284911 hasConceptScore W2020284911C2778597767 @default.
• W2020284911 hasConceptScore W2020284911C2779742124 @default.
• W2020284911 hasConceptScore W2020284911C2781338088 @default.
• W2020284911 hasConceptScore W2020284911C43617362 @default.
• W2020284911 hasConceptScore W2020284911C55493867 @default.
• W2020284911 hasConceptScore W2020284911C73583747 @default.
• W2020284911 hasIssue "2" @default.
• W2020284911 hasLocation W20202849111 @default.
• W2020284911 hasLocation W20202849112 @default.
• W2020284911 hasOpenAccess W2020284911 @default.
• W2020284911 hasPrimaryLocation W20202849111 @default.
• W2020284911 hasRelatedWork W1989632829 @default.

• next