Matches in SemOpenAlex for { <https://semopenalex.org/work/W2021058840> ?p ?o ?g. }
- W2021058840 endingPage "1150" @default.
- W2021058840 startingPage "1146" @default.
- W2021058840 abstract "A novel lumbricin-like antimicrobial peptide named lumbricin-PG was isolated from skin secretions of the earthworm, Pheretima guillelmi (Michaelsen), using a procedure of one step Sephadex G-50 gel filtration and one step C(8) reverse-phase high-performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined as FSRYARMRDSRPWSDRKNNYSGPQFTYPPEKAPPEKLIKWNN EGSPIFEMPAEGGHIEP by Edman degradation combined with cDNA cloning and mass spectrometry analysis. The cDNA encoding lumbricin-PG was cloned by cDNA library screening. The predicted protein from the cDNA sequence was composed of 73 amino acid residues including a mature lumbricin-PG and predicted signal peptide. It showed similarity with lumbricin antimicrobial peptide from the earthworm, Lumbricus rubellus by BLAST search. Purified lumbricin-PG exerted potential antimicrobial activities against bacteria and fungi; it showed weak hemolysis activity against human and rabbit red cells." @default.
- W2021058840 created "2016-06-24" @default.
- W2021058840 creator A5026544444 @default.
- W2021058840 creator A5034868438 @default.
- W2021058840 creator A5048912470 @default.
- W2021058840 creator A5053253277 @default.
- W2021058840 creator A5062561595 @default.
- W2021058840 creator A5069323812 @default.
- W2021058840 date "2011-06-01" @default.
- W2021058840 modified "2023-09-26" @default.
- W2021058840 title "A novel antimicrobial peptide from skin secretions of the earthworm, Pheretima guillelmi (Michaelsen)" @default.
- W2021058840 cites W1482180296 @default.
- W2021058840 cites W1973418628 @default.
- W2021058840 cites W1986358280 @default.
- W2021058840 cites W1997152791 @default.
- W2021058840 cites W2001959707 @default.
- W2021058840 cites W2006519770 @default.
- W2021058840 cites W2026482455 @default.
- W2021058840 cites W2028172389 @default.
- W2021058840 cites W2030887543 @default.
- W2021058840 cites W2045403632 @default.
- W2021058840 cites W2059903590 @default.
- W2021058840 cites W2060486005 @default.
- W2021058840 cites W2074631110 @default.
- W2021058840 cites W2079468421 @default.
- W2021058840 cites W2085929853 @default.
- W2021058840 cites W2087028779 @default.
- W2021058840 cites W2097398376 @default.
- W2021058840 cites W2102808860 @default.
- W2021058840 cites W2114241862 @default.
- W2021058840 cites W2123106599 @default.
- W2021058840 cites W2132346351 @default.
- W2021058840 cites W2138021049 @default.
- W2021058840 cites W2141854312 @default.
- W2021058840 cites W2146312832 @default.
- W2021058840 cites W2182270228 @default.
- W2021058840 cites W295661435 @default.
- W2021058840 doi "https://doi.org/10.1016/j.peptides.2011.04.015" @default.
- W2021058840 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/21539875" @default.
- W2021058840 hasPublicationYear "2011" @default.
- W2021058840 type Work @default.
- W2021058840 sameAs 2021058840 @default.
- W2021058840 citedByCount "38" @default.
- W2021058840 countsByYear W20210588402013 @default.
- W2021058840 countsByYear W20210588402014 @default.
- W2021058840 countsByYear W20210588402015 @default.
- W2021058840 countsByYear W20210588402016 @default.
- W2021058840 countsByYear W20210588402017 @default.
- W2021058840 countsByYear W20210588402018 @default.
- W2021058840 countsByYear W20210588402019 @default.
- W2021058840 countsByYear W20210588402020 @default.
- W2021058840 countsByYear W20210588402021 @default.
- W2021058840 countsByYear W20210588402022 @default.
- W2021058840 countsByYear W20210588402023 @default.
- W2021058840 crossrefType "journal-article" @default.
- W2021058840 hasAuthorship W2021058840A5026544444 @default.
- W2021058840 hasAuthorship W2021058840A5034868438 @default.
- W2021058840 hasAuthorship W2021058840A5048912470 @default.
- W2021058840 hasAuthorship W2021058840A5053253277 @default.
- W2021058840 hasAuthorship W2021058840A5062561595 @default.
- W2021058840 hasAuthorship W2021058840A5069323812 @default.
- W2021058840 hasConcept C104317684 @default.
- W2021058840 hasConcept C151730666 @default.
- W2021058840 hasConcept C153911025 @default.
- W2021058840 hasConcept C163994747 @default.
- W2021058840 hasConcept C167625842 @default.
- W2021058840 hasConcept C181199279 @default.
- W2021058840 hasConcept C185592680 @default.
- W2021058840 hasConcept C187882448 @default.
- W2021058840 hasConcept C189482833 @default.
- W2021058840 hasConcept C2776332788 @default.
- W2021058840 hasConcept C2779281246 @default.
- W2021058840 hasConcept C2779955632 @default.
- W2021058840 hasConcept C43617362 @default.
- W2021058840 hasConcept C4937899 @default.
- W2021058840 hasConcept C515207424 @default.
- W2021058840 hasConcept C540938839 @default.
- W2021058840 hasConcept C55493867 @default.
- W2021058840 hasConcept C86803240 @default.
- W2021058840 hasConcept C87933860 @default.
- W2021058840 hasConcept C89423630 @default.
- W2021058840 hasConceptScore W2021058840C104317684 @default.
- W2021058840 hasConceptScore W2021058840C151730666 @default.
- W2021058840 hasConceptScore W2021058840C153911025 @default.
- W2021058840 hasConceptScore W2021058840C163994747 @default.
- W2021058840 hasConceptScore W2021058840C167625842 @default.
- W2021058840 hasConceptScore W2021058840C181199279 @default.
- W2021058840 hasConceptScore W2021058840C185592680 @default.
- W2021058840 hasConceptScore W2021058840C187882448 @default.
- W2021058840 hasConceptScore W2021058840C189482833 @default.
- W2021058840 hasConceptScore W2021058840C2776332788 @default.
- W2021058840 hasConceptScore W2021058840C2779281246 @default.
- W2021058840 hasConceptScore W2021058840C2779955632 @default.
- W2021058840 hasConceptScore W2021058840C43617362 @default.
- W2021058840 hasConceptScore W2021058840C4937899 @default.
- W2021058840 hasConceptScore W2021058840C515207424 @default.
- W2021058840 hasConceptScore W2021058840C540938839 @default.
- W2021058840 hasConceptScore W2021058840C55493867 @default.