FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W2023280415> ?p ?o ?g. }

• W2023280415 endingPage "2932" @default.
• W2023280415 startingPage "2929" @default.
• W2023280415 abstract "There is a great urgency in developing a new generation of antibiotics and antimicrobial agents since the bacterial resistance to antibiotics have increased dramatically. A series of overlapped peptide fragments of Ixosin-B, an antimicrobial peptide with amino acid sequence of QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY, was designed, synthesized and examined for their antimicrobial activities against Escherichia coli, Staphylococcus aureus, and Pseudomonas aeruginosa. A potent 11-mer peptide TSG-8-1, WWSYVRRWRSR-amide, was developed, which exhibited antimicrobial activity against E. coli and S. aureus while very little hemolytic activity in human erythrocytes was observed at high dose level. This peptide could be further modified for the development of a potent antimicrobial agent in the future." @default.
• W2023280415 created "2016-06-24" @default.
• W2023280415 creator A5003629962 @default.
• W2023280415 creator A5022373795 @default.
• W2023280415 creator A5025052494 @default.
• W2023280415 creator A5047307531 @default.
• W2023280415 date "2013-05-01" @default.
• W2023280415 modified "2023-09-25" @default.
• W2023280415 title "Structure–activity relationship of potent antimicrobial peptide analogs of Ixosin-B amide" @default.
• W2023280415 cites W1980441078 @default.
• W2023280415 cites W1991081822 @default.
• W2023280415 cites W1992486144 @default.
• W2023280415 cites W1996161385 @default.
• W2023280415 cites W1997152791 @default.
• W2023280415 cites W1997868832 @default.
• W2023280415 cites W2001784720 @default.
• W2023280415 cites W2008494805 @default.
• W2023280415 cites W2009198292 @default.
• W2023280415 cites W2039276129 @default.
• W2023280415 cites W2054602599 @default.
• W2023280415 cites W2056123667 @default.
• W2023280415 cites W2060242640 @default.
• W2023280415 cites W2069888185 @default.
• W2023280415 cites W2081882008 @default.
• W2023280415 cites W2089175291 @default.
• W2023280415 cites W2113770412 @default.
• W2023280415 cites W2160780417 @default.
• W2023280415 cites W2160909613 @default.
• W2023280415 cites W2170792377 @default.
• W2023280415 cites W2332177486 @default.
• W2023280415 doi "https://doi.org/10.1016/j.bmcl.2013.03.053" @default.
• W2023280415 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/23570790" @default.
• W2023280415 hasPublicationYear "2013" @default.
• W2023280415 type Work @default.
• W2023280415 sameAs 2023280415 @default.
• W2023280415 citedByCount "3" @default.
• W2023280415 countsByYear W20232804152021 @default.
• W2023280415 countsByYear W20232804152022 @default.
• W2023280415 crossrefType "journal-article" @default.
• W2023280415 hasAuthorship W2023280415A5003629962 @default.
• W2023280415 hasAuthorship W2023280415A5022373795 @default.
• W2023280415 hasAuthorship W2023280415A5025052494 @default.
• W2023280415 hasAuthorship W2023280415A5047307531 @default.
• W2023280415 hasConcept C104317684 @default.
• W2023280415 hasConcept C167625842 @default.
• W2023280415 hasConcept C178790620 @default.
• W2023280415 hasConcept C185592680 @default.
• W2023280415 hasConcept C2777637488 @default.
• W2023280415 hasConcept C2779281246 @default.
• W2023280415 hasConcept C2779489039 @default.
• W2023280415 hasConcept C3019249092 @default.
• W2023280415 hasConcept C4937899 @default.
• W2023280415 hasConcept C501593827 @default.
• W2023280415 hasConcept C523546767 @default.
• W2023280415 hasConcept C540938839 @default.
• W2023280415 hasConcept C54355233 @default.
• W2023280415 hasConcept C547475151 @default.
• W2023280415 hasConcept C55493867 @default.
• W2023280415 hasConcept C86803240 @default.
• W2023280415 hasConcept C89423630 @default.
• W2023280415 hasConcept C94665300 @default.
• W2023280415 hasConceptScore W2023280415C104317684 @default.
• W2023280415 hasConceptScore W2023280415C167625842 @default.
• W2023280415 hasConceptScore W2023280415C178790620 @default.
• W2023280415 hasConceptScore W2023280415C185592680 @default.
• W2023280415 hasConceptScore W2023280415C2777637488 @default.
• W2023280415 hasConceptScore W2023280415C2779281246 @default.
• W2023280415 hasConceptScore W2023280415C2779489039 @default.
• W2023280415 hasConceptScore W2023280415C3019249092 @default.
• W2023280415 hasConceptScore W2023280415C4937899 @default.
• W2023280415 hasConceptScore W2023280415C501593827 @default.
• W2023280415 hasConceptScore W2023280415C523546767 @default.
• W2023280415 hasConceptScore W2023280415C540938839 @default.
• W2023280415 hasConceptScore W2023280415C54355233 @default.
• W2023280415 hasConceptScore W2023280415C547475151 @default.
• W2023280415 hasConceptScore W2023280415C55493867 @default.
• W2023280415 hasConceptScore W2023280415C86803240 @default.
• W2023280415 hasConceptScore W2023280415C89423630 @default.
• W2023280415 hasConceptScore W2023280415C94665300 @default.
• W2023280415 hasIssue "10" @default.
• W2023280415 hasLocation W20232804151 @default.
• W2023280415 hasLocation W20232804152 @default.
• W2023280415 hasOpenAccess W2023280415 @default.
• W2023280415 hasPrimaryLocation W20232804151 @default.
• W2023280415 hasRelatedWork W1968602861 @default.
• W2023280415 hasRelatedWork W2098529683 @default.
• W2023280415 hasRelatedWork W2339863258 @default.
• W2023280415 hasRelatedWork W2358714904 @default.
• W2023280415 hasRelatedWork W2626184144 @default.
• W2023280415 hasRelatedWork W2964010063 @default.
• W2023280415 hasRelatedWork W2985891204 @default.
• W2023280415 hasRelatedWork W3084005743 @default.
• W2023280415 hasRelatedWork W3108873220 @default.
• W2023280415 hasRelatedWork W4293234733 @default.
• W2023280415 hasVolume "23" @default.
• W2023280415 isParatext "false" @default.
• W2023280415 isRetracted "false" @default.
• W2023280415 magId "2023280415" @default.

• next