FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W2052519363> ?p ?o ?g. }

• W2052519363 endingPage "38521" @default.
• W2052519363 startingPage "38513" @default.
• W2052519363 abstract "Aedes aegypti chorion peroxidase (CPO) plays a crucial role in chorion hardening by catalyzing chorion protein cross-linking through dityrosine formation. The enzyme is extremely resistant to denaturing conditions, which seem intimately related to its post-translational modifications, including disulfide bond formation and glycosylation. In this report, we have provided data that describe a new type of glycosylation in CPO, where a mannose is linked to the N-1 atom of the indole ring of Trp residue. Through liquid chromatography/electrospray ionization/tandem mass spectrometry and de novo sequencing of CPO tryptic peptides, we determined that three of the seven available Trp residues in mature CPO are partially (40–50%) or completely mannosylated. This conclusion is based on the following properties of the electrospray ionization/tandem mass spectrometry spectra and the enzymatic reaction of these peptides: 1) the presence of a 162-Da substituent in each Trp residue; 2) the presence of abundant fragments of m/z 163 ([Hex + H]) and [M + H - 162] (typical for N-glycosides); 3) the absence of a loss of 120 Da (this loss is typical for aromatic C-glycosides); and 4) the cleavage of the glycosidic linkage by PNGase A or F (typical for N-glycans). These results establish that a C–N bond is formed between the anomeric carbon of a mannose residue and the N-1 atom of the indole ring of Trp. This is the first report that provides definitive evidence for N-mannosylation of Trp residues in a protein. In addition, our data demonstrate that PNGase can hydrolyze Trp N-linked mannose in peptides, which is unusual because no typical β-amide bond is present in the Trp-mannosyl moiety. Results of this study should stimulate research toward a comprehensive understanding of physiology and biochemistry of Trp N-mannosylation in proteins and the overall biochemical mechanisms of PNGase-catalyzed reactions. Aedes aegypti chorion peroxidase (CPO) plays a crucial role in chorion hardening by catalyzing chorion protein cross-linking through dityrosine formation. The enzyme is extremely resistant to denaturing conditions, which seem intimately related to its post-translational modifications, including disulfide bond formation and glycosylation. In this report, we have provided data that describe a new type of glycosylation in CPO, where a mannose is linked to the N-1 atom of the indole ring of Trp residue. Through liquid chromatography/electrospray ionization/tandem mass spectrometry and de novo sequencing of CPO tryptic peptides, we determined that three of the seven available Trp residues in mature CPO are partially (40–50%) or completely mannosylated. This conclusion is based on the following properties of the electrospray ionization/tandem mass spectrometry spectra and the enzymatic reaction of these peptides: 1) the presence of a 162-Da substituent in each Trp residue; 2) the presence of abundant fragments of m/z 163 ([Hex + H]) and [M + H - 162] (typical for N-glycosides); 3) the absence of a loss of 120 Da (this loss is typical for aromatic C-glycosides); and 4) the cleavage of the glycosidic linkage by PNGase A or F (typical for N-glycans). These results establish that a C–N bond is formed between the anomeric carbon of a mannose residue and the N-1 atom of the indole ring of Trp. This is the first report that provides definitive evidence for N-mannosylation of Trp residues in a protein. In addition, our data demonstrate that PNGase can hydrolyze Trp N-linked mannose in peptides, which is unusual because no typical β-amide bond is present in the Trp-mannosyl moiety. Results of this study should stimulate research toward a comprehensive understanding of physiology and biochemistry of Trp N-mannosylation in proteins and the overall biochemical mechanisms of PNGase-catalyzed reactions. Glycosylation is the most abundant post-translational modification in proteins. Based on the linkage of oligosaccharides with amino acid residues on proteins, O-glycosylation and N-glycosylation are the two best known types and have been extensively studied (1.Varki A. Cummings R. Esko J. Freeze H. Hart G. Marth J. Essentials of Glycobiology. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY1999: 85-113Google Scholar). In O-glycosylation, sugar is attached to the hydroxyl group of serine, threonine, tyrosine, or other amino acid residues through a hydroxyl group. In N-glycosylation, oligosaccharide is linked to the peptide through N-acetylglucosamine and asparagine with a recognition sequence of Asn-X-Ser/Thr, where X can be any amino acid except for proline. During the past 10 years, a new type of protein glycosylation involving attachment of an α-mannose to the C-2 carbon of the indole ring of Trp residues in proteins has been reported (2.Hofsteenge J. Muller D.R. de Beer T. Löffler A. Richter W.J. Vliegenthart J.F.G. Biochemistry. 1994; 33: 13524-13530Crossref PubMed Scopus (244) Google Scholar, 3.De Beer T. Vliegenthart J.F.G. Löffler A. Hofsteenge J. Biochemistry. 1995; 34: 12005-12014Crossref PubMed Scopus (98) Google Scholar, 4.Löffler A. Doucey M.A. Jansson A.M. Müller D.R. de Beer T. Hess D. Meldal M. Richter W.J. Vliegenthart J.F.G. Hofsteenge J. Biochemistry. 1996; 35: 12005-12014Crossref PubMed Scopus (67) Google Scholar). It is termed C-glycosylation because this linkage is formed via a C–C bond. C-mannosylation has been proved to occur in a number of mammalian proteins, such as RNase2, interleukin-12, complements, properdin, thrombospondin, erythropoietin receptor, mucins, and a bovine lens protein (2.Hofsteenge J. Muller D.R. de Beer T. Löffler A. Richter W.J. Vliegenthart J.F.G. Biochemistry. 1994; 33: 13524-13530Crossref PubMed Scopus (244) Google Scholar, 3.De Beer T. Vliegenthart J.F.G. Löffler A. Hofsteenge J. Biochemistry. 1995; 34: 12005-12014Crossref PubMed Scopus (98) Google Scholar, 4.Löffler A. Doucey M.A. Jansson A.M. Müller D.R. de Beer T. Hess D. Meldal M. Richter W.J. Vliegenthart J.F.G. Hofsteenge J. Biochemistry. 1996; 35: 12005-12014Crossref PubMed Scopus (67) Google Scholar, 5.Krieg J. Glasner W. Vicentini A. Doucey M.A. Löffler A. Hess D. Hofsteenge J. J. Biol. Chem. 1997; 272: 26687-26692Abstract Full Text Full Text PDF PubMed Scopus (62) Google Scholar, 6.Krieg J. Hartmann S. Vicentini A. Glasner W. Hess D. Hofsteenge J. Mol. Biol. Cell. 1998; 9: 301-309Crossref PubMed Scopus (121) Google Scholar, 7.Doucey M.A. Hess D. Blommers M.J. Hofsteenge J. Glycobiology. 1999; 9: 435-441Crossref PubMed Scopus (80) Google Scholar, 8.Hofsteenge J. Blommers M. Hess D. Furmanek A. Miroshnichenko O. J. Biol. Chem. 1999; 274: 32786-32794Abstract Full Text Full Text PDF PubMed Scopus (96) Google Scholar, 9.Hartmann S. Hofsteenge J. J. Biol. Chem. 2000; 275: 28569-28574Abstract Full Text Full Text PDF PubMed Scopus (83) Google Scholar, 10.Gonzalez de Peredo A. Klein D. Macek B. Hess D. Peter-Katalinic J. Hofsteenge J. Mol. Cell. Proteomics. 2002; 1: 11-18Abstract Full Text Full Text PDF PubMed Scopus (102) Google Scholar, 11.Hofsteenge J. Huwiler K.G. Macek B. Hess D. Lawler J. Mosher D.F. Peter-Katalinic J. J. Biol. Chem. 2001; 276: 6485-6498Abstract Full Text Full Text PDF PubMed Scopus (211) Google Scholar, 13.Perez-Vilar J. Randell S.H. Boucher R.C. Glycobiology. 2004; 14: 325-337Crossref PubMed Scopus (87) Google Scholar, 14.Hilton D.J. Watowich S.S. Katz L. Lodish H.F. J. Biol. Chem. 1996; 271: 4699-4708Abstract Full Text Full Text PDF PubMed Scopus (102) Google Scholar, 15.Ihara Y. Manabe S. Kanda M. Kawano H. Nakayama T. Sekine I. Kondo T. Ito Y. Glycobiology. 2005; 15: 383-392Crossref PubMed Scopus (30) Google Scholar, 16.Ervin L.A. Ball L.E. Crouch R.K. Schey K.L. Investig. Ophthalmol. Vis. Sci. 2005; 46: 627-635Crossref PubMed Scopus (28) Google Scholar). A Trp-X-X-Trp (WXXW) motif seems to serve as the specificity determinant for C-mannosylation, in which the first Trp residue is mannosylated. In addition, it has been demonstrated that the C-mannosylation is an enzyme-catalyzed event (17.Doucey M.A. Hess D. Cacan R. Hofsteenge J. Mol. Biol. Cell. 1998; 9: 291-300Crossref PubMed Scopus (141) Google Scholar). The potential function of the C-mannosylation has also been discussed in a recent report (15.Ihara Y. Manabe S. Kanda M. Kawano H. Nakayama T. Sekine I. Kondo T. Ito Y. Glycobiology. 2005; 15: 383-392Crossref PubMed Scopus (30) Google Scholar). In our study dealing with mosquito chorion hardening, we identified a specific chorion peroxidase (CPO) 2The abbreviations used are: CPO, chorion peroxidase; PNGase, peptide-N-glycosidase; LC, liquid chromatography; ESI, electrospray ionization; MS, mass spectrometry. that displayed extremely high physical stability under a number of denaturing conditions. For example, the enzyme remains active for months in 1–5% SDS (18.Han Q. Li G. Li J. Arch. Biochem. Biophys. 2000; 378: 107-115Crossref PubMed Scopus (27) Google Scholar). CPO undergoes extensive post-translational modifications, including proteolytic processing and glycosylation (19.Li J.S. Kim S.R. Li J. Insect Biochem. Mol. Biol. 2004; 34: 1195-1203Crossref PubMed Scopus (21) Google Scholar). Recently, we have determined the N-glycosylation site and N-glycan structures in CPO (20.Li J.S. Li J. Protein Sci. 2005; 14: 2370-2386Crossref PubMed Scopus (5) Google Scholar). In our current study dealing with the characterization of CPO post-translational modifications, we determined that some Trp residues in CPO were mannosylated. Further analysis of their MS/MS spectra determined that the mannosyl moiety is not linked via the anomeric carbon to the C2 atom of the Trp indole ring as those described for a number of mammalian proteins (2.Hofsteenge J. Muller D.R. de Beer T. Löffler A. Richter W.J. Vliegenthart J.F.G. Biochemistry. 1994; 33: 13524-13530Crossref PubMed Scopus (244) Google Scholar, 3.De Beer T. Vliegenthart J.F.G. Löffler A. Hofsteenge J. Biochemistry. 1995; 34: 12005-12014Crossref PubMed Scopus (98) Google Scholar, 4.Löffler A. Doucey M.A. Jansson A.M. Müller D.R. de Beer T. Hess D. Meldal M. Richter W.J. Vliegenthart J.F.G. Hofsteenge J. Biochemistry. 1996; 35: 12005-12014Crossref PubMed Scopus (67) Google Scholar) but is covalently connected via the N-1 atom of the side chain of Trp. Although a Trp N-linked glycoconjugate has been detected in fruit (21.Diem S. Bergmann J. Herderich M. J. Agric. Food Chem. 2000; 48: 4913-4917Crossref PubMed Scopus (31) Google Scholar, 22.Gutsche B. Grun C. Scheutzow D. Herderich M. Biochem. J. 1999; 343: 11-19Crossref PubMed Scopus (64) Google Scholar), N-mannosylation of the peptide-associated Trp has not been clearly identified as a protein post-translational event or as a new type of protein glycosylation. The detection of Trp N-mannosylation in CPO raises some interesting questions, such as questions concerning the enzymes involved in catalyzing the Trp N-mannosylation or hydrolyzing the Trp N-linked mannose in proteins and, more importantly, the physiological function of the Trp N-mannosylation in proteins, which should stimulate further research in these directions. Materials—PNGase A, PNGase F, and Asp-N were purchased from Sigma. Modified trypsin was from Promega (Madison). ZipTip C18 was from Millipore (Bedford, MA). Fresh Milli-Q water was used to prepare all buffers. Other laboratory chemicals were purchased from Sigma or Fisher (Fairlawn, NJ). CPO Purification—Chorion isolation and CPO purification were based on a previously described method (20.Li J.S. Li J. Protein Sci. 2005; 14: 2370-2386Crossref PubMed Scopus (5) Google Scholar). Purity of the isolated CPO was assessed by SDS-PAGE. Protein concentration was determined at 280 nm with a U2001 spectrophotometer (Hitachi, Tokyo, Japan). In-gel Digestion—CPO was electrophoresed on a SDS-PAGE gel and stained with Coomassie Blue. The CPO band was cut from the gel and transferred into a 0.6-ml siliconized microcentrifuge tube (Fisher). After dithiothreitol reduction and iodoacetamide alkylation, CPO was in-gel digested with 0.01 μg/μl trypsin in 50 mm Tris-HCl (pH 8.0) at 37 °C for 16 h. Tryptic peptides were extracted from the gel using 50% acetonitrile in water plus sonication. After evaporation with a Speed-Vac, peptides were redissolved in 0.1% formic acid and desalted with ZipTip C18 for subsequent analysis using LC/ESI/MS/MS. Enzymatic Deglycosylation of CPO—In enzymatic deglycosylation, a denaturing protocol was used (23.Kuster B. Wheeler S.F. Hunter A.P. Dwek R.A. Harvey D.J. Anal. Biochem. 1997; 250: 82-101Crossref PubMed Scopus (323) Google Scholar). CPO (4 μg) was first digested with trypsin. The tryptic peptides were incubated with 25 microunits of PNGase A in 5 μl of 50 mm citrate-phosphate buffer (pH 5.0) (or 0.5 unit of PNGase F in 5 μl of 20 mm NaHCO3, pH 7.0) at 37 °C for 24 h. The deglycosylated peptides were desalted using ZipTip C18 and subsequently analyzed by LC/ESI/MS/MS. To determine the stability of the glycosidic linkage under the applied deglycosylation conditions, CPO tryptic peptides were incubated in 50 mm citrate-phosphate buffer (pH 5.0) without PNGase at 37 °C for 24 h and then applied to LC/ESI/MS/MS following desalting. NanoLC/ESI/MS/MS for Glycopeptide Sequencing—The nanoLC/ESI/MS/MS system consists of a CapLC XE fitted with a NanoEase 75-μm C18 column, an OPTI-PAK C18 Trap column, and a Q-TOF micro™ mass spectrometer with a nanospray source (Waters Micromass, Manchester, UK). Peptide separation was achieved by gradient elution with mobile phase A (5% acetonitrile in 0.1% formic acid) and mobile phase B (90% acetonitrile in 0.1% formic acid). The following gradient profile was applied: 5% B from 0 to 5 min, 5–40% B from 6 to 40 min, and 40–90% B from 40 to 65 min. In MS analysis of peptides, precursor ions that were not matched to the deduced CPO tryptic peptide map, due presumably to post-translational modification, were selected and extracted into the collision cells for dissociation. In MS/MS analysis, identification of potential glycopeptides was based on the presence of marker ions of m/z 163, m/z 204, or m/z 366. The structures of the glycopeptides were elucidated based on their MS/MS spectra. Determination of Modified CPO Tryptic Peptides—Figs. 1, 2, and 3 show the peptide maps of unincubated buffer and PNGase-A incubated and buffer-alone incubated CPO tryptic peptides, respectively. When trypsin-digested CPO peptides were analyzed by LC/ESI/MS/MS and its resulting peptide ions were searched against the peptide map generated using the deduced sequence of CPO from its cDNA, a number of peptide ions did not match the deduced CPO sequence (Fig. 1). Among the unmatched ions, a number of low intensity peaks with masses of 3,502–4,116 Da have been previously identified as N-glycosylated peptides (20.Li J.S. Li J. Protein Sci. 2005; 14: 2370-2386Crossref PubMed Scopus (5) Google Scholar). However, several high intensity ions, including 1,343, 1,398, and 1,763 Da, also did not match the deduced CPO tryptic map (see Fig. 1). After the CPO tryptic peptides were treated with either PNGase A or F, the low intensity ions of 3,502–4,116 Da (seen in Fig. 1) essentially disappeared, which is in agreement with our previous report (20.Li J.S. Li J. Protein Sci. 2005; 14: 2370-2386Crossref PubMed Scopus (5) Google Scholar), but the peaks of 1343, 1398, and 1763 Da also disappeared from the MS spectrum of the PNGase-deglycosylated peptides. At the same time, several new peaks, i.e. 1,181, 1,662, and 2,466 Da, were observed in the MS spectrum of deglycosylated CPO peptides (see Fig. 2). In addition, the relative intensity of 1,236 and 1,601 Da was conspicuously increased in the MS spectrum of the deglycosylated peptides (see Figs. 1 and 2). When the CPO tryptic peptides were incubated in the same citrate-phosphate buffer (pH 5.0) in the absence of PNGase, disappearance of 1,343, 1,398, and 1,763 Da was not observed in the MS spectrum of the CPO tryptic peptides (Fig. 3), suggesting that the potential glycosidic linkage of the three peptide ions was stable to the applied incubation conditions. Because the disappearance of all three ions (1,343, 1,398, and 1,763 Da) from the peptide MS spectrum was directly related to PNGase-mediated reactions, their primary structures were thoroughly analyzed, which eventually led to the identification of a unusual N-linked hexose (a 162-Da substituent) structure in these peptides.FIGURE 2LC/ESI/MS spectra of tryptic peptides of CPO following PNGase A deglycosylation. The peaks labeled with double asterisks are new peak or peaks with their relative intensity increased after PNGase deglycosylation. Note that all peaks of hexosyl peptides (1,343, 1,398, and 1,763 Da) shown in Fig. 1 are absent here. This result strongly implies that these glycopeptides have a novel N-linked hexose structure. The peaks around mass of 2466 Da are N-deglycosylated peptides.View Large Image Figure ViewerDownload Hi-res image Download (PPT)FIGURE 3LC/ESI/MS spectra of tryptic peptides of CPO following incubation in 50 mm citrate-phosphate buffer (pH 5.0) (buffer control). The peptide map, including the putative glycosylated fragments, is very similar to the untreated sample (Fig. 1), indicating that these N-glycosidic linkages are stable with regard to the incubation condition of deglycosylation. The peaks labeled with a single asterisk are those not matched to the deduced CPO sequence and subsequently identified as hexosyl peptides. Peaks labeled with double asterisks are the corresponding peptides that are not substituted by hexose.View Large Image Figure ViewerDownload Hi-res image Download (PPT) MS/MS Spectra of the Hexosyl Peptides and Localization of Hexosyl Residues—Based on the MS/MS spectrum of the m/z 1,343, some partial sequences, NPH and DDER, were derived based on the presumed y and b series ions (Fig. 4A). Comparison of these partial sequences with the deduced CPO sequence matched them to a CPO tryptic peptide, 476INPHWDDER484. However, its calculated peptide ion is 1,181, which is 162 Da less than the m/z 1,343. Search of the deglycosylated MS spectrum of CPO tryptic peptides indeed revealed a new peak with m/z 1,181 (see Fig. 2B), and the fragmentation pattern (MS/MS spectrum) of its peptide ion perfectly matched the INPHWDDER sequence (Fig. 4B). Comparison of the MS/MS spectra between m/z 1,343 and 1,181 revealed that both corresponded to the same peptide, except that the Trp residue in the native peptide was modified, because its residue became 348 Da, which was 162 Da above its expected mass (Fig. 4, A and B). Because the substituent linked to the Trp residue was released by deglycosylation and a low mass hexose marker ion of m/z 163 was also present in the MS/MS spectrum of its native (undeglycosylated) peptides (Fig. 4A), it was apparent that a hexosyl moiety was linked to the Trp residue in the peptide. In our previous study (20.Li J.S. Li J. Protein Sci. 2005; 14: 2370-2386Crossref PubMed Scopus (5) Google Scholar), we showed that mannose is the only hexose in CPO monosaccharide composition. Therefore, the 162-Da substituent is considered to be a mannose. Similarly, the m/z 1,398 and m/z 1,763 that also disappeared after deglycosylation were first subtracted by 162 Da and the possible presence of their [M + H - 162], i.e. m/z 1,236 and m/z 1,601, were searched in the MS spectra of both native and deglycosylated CPO peptide samples. Interestingly, both m/z 1,236 and m/z 1,601 were present in the native and deglycosylated peptides, but the relative intensities of these peptide ions were much greater in the deglycosylated peptides than in the native peptides (see Figs. 1 and 2). De novo sequencing of the m/z 1,398 and m/z 1,236 pair, based on their MS/MS spectra, revealed that both peptide ions corresponded to the same CPO peptide of 778YDTVNLGLWR787 except that the Trp residue in m/z 1,398 was conjugated with a 162-Da constituent, presumably a mannosyl residue (Fig. 5, A and B). Using the same approach, it was determined that the m/z 1,763 and m/z 1,601 pair corresponded to the same 250VLEPAYEDGVWAPR263 CPO peptide, and again the Trp residue in m/z 1,763 seemed to be conjugated with a mannosyl residue (Fig. 6, A and B). Because both [M + H - 162] and [M + H] for the 250VLEPAYEDGVWAPR263 and 778YDTVNLGLWR787 peptide ions were present in the MS spectrum of the native CPO peptides, it was clear that not all Trp residues in these two peptides were modified by a mannosyl residue. Based on the relative intensity between their [M + H - 162] and [M + H] in the MS spectrum of the native CPO peptides, we determined that ∼40–50% of the Trp residues in the 250VLEPAYEDGVWAPR263 and 778YDTVNLGLWR787 peptides were modified by a mannose. A summary of identified tryptic peptides and their modifications is provided in TABLE ONE.FIGURE 6MS/MS spectra of precursor m/z 1,764 (a mannosylated peptide) (A) and m/z 1,602 (the deglycosylated peptide) (B) after PNGase A treatment. Note that the mannosylated Trp residue (348 Da) changed to Trp residue (186 Da) following deglycosylation.View Large Image Figure ViewerDownload Hi-res image Download (PPT)TABLE ONEDe novo sequencing and post-translational modifications of chorion peroxidaseObserved massaMonoisotopic massDeduced massStartEndSequences, potential PTMsbPTMs, post-translational modifications. The chemical modifications during sample preparation, such asiodoacetamide alkylation or acrylamide adduct, were not listed1448.231447.67211222CLPPVPCSPHSR, acetyl C211cThe modification was determined basing on observed peptide mass1471.381471.67225237TIDGSCNNPLPDR1444.331444.61238249TSWGMEGYPFDR1600.491600.79250263VLEPAYEDGVWAPR1762.541762.84VLEPAYEDGVWAPR, W260-hexose1873.341872.97277292VISVALFPDEYRPDPR2428.502429.19293312LNILFMQMGQFISHDFTLSR552.190552.291313317GFTTK3356.343356.39318338HGQAIECCTPNCTAPLFGPHRN328-Man3GlcNAc23502.333502.45HGQAIECCTPNCTAPLFGPHRN328-Man3 (Fuc) GlcNAc24004.394004.88HGQAIECCTPNCTAPLFGPHRN328-Man7GlcNAc24166.304166.93HGQAIECCTPNCTAPLFGPHRN328-Man7GlcNAc22205.572206.03339356HFACFPIEVPPNDPFYSR2222.312222.03HFACFPIEVPPNDPFYSRY354-OH (dopa)1447.431447.71369381LAQGPECQLGYAK2791.862792.36382407QADLVTHFLDASTVYGSTNDVAAELR1816.411815.99414429LKDSFPNGIELLPFAR1574.501574.81416429DSFPNGIELLPFAR1243.671243.62430439NRTACVPWAR973.25973.460432439TACVPWAR1081.281081.49440448VCYEGGDIR1873.621873.99449464TNQLLGLTMVHTLFMR, H for Y462554.159554.256465468EHNR1342.371342.58476484INPHWDDER, W480-hexose934.470934.498485491LYQEARR3922.533922.89515549VQQLGLADPFDTYTNYYDPNLRPMTLAEVGAAAHR1310.371310.64550560YGHSLVEGFFR1159.361159.58565574ESPPEDVFIK2075.602076.01565582ESPPEDVFIKDIFNDPSK969.336969.528607614FLTYGLTR1544.541544.83621634KPFGSDLASLNIQR1415.211414.66637647DFAVRPYNDYR5873.635874.94655709ITDFNQLGEVGALLAQVYESPDDVDLWPGGVLEPPAEGAVVGPTFVALLSAGYTRX (S, T, Y,or W)-hexosecThe modification was determined basing on observed peptide mass2921.212921.47713738ADRYYFTNGPEVNPGALTLQQLGEIR1497.501497.76740753TTLAGIICANADHK2848.452848.38740764TTLAGIICANADHKEDFYQAQEALR1368.391368.63754764EDFYQAQEALR1443.421443.68765777QSSADNVPVPCTR1235.361235.63778787YDTVNLGLWR1397.471397.68YDTVNLGLWR, W786-hexosea Monoisotopic massb PTMs, post-translational modifications. The chemical modifications during sample preparation, such asiodoacetamide alkylation or acrylamide adduct, were not listedc The modification was determined basing on observed peptide mass Open table in a new tab Linkage between the Hexose and the Trp Residue in CPO—The MS/MS spectra of the three peptides (native or deglycosylated) demonstrated that a mannosyl residue is linked to the corresponding Trp residue. In each case, there were abundant peaks at m/z 163 and [M + H - 162], whereas essentially no peak of [M + H - 120] was observed in the MS/MS spectra of native peptides (Figs. 4, 5, 6). A loss of 162 Da is characteristic of an N- or O-linked sugar complex, and a loss of 120 Da is typical for an aromatic C-linked sugar complex or peptides (2.Hofsteenge J. Muller D.R. de Beer T. Löffler A. Richter W.J. Vliegenthart J.F.G. Biochemistry. 1994; 33: 13524-13530Crossref PubMed Scopus (244) Google Scholar, 3.De Beer T. Vliegenthart J.F.G. Löffler A. Hofsteenge J. Biochemistry. 1995; 34: 12005-12014Crossref PubMed Scopus (98) Google Scholar, 4.Löffler A. Doucey M.A. Jansson A.M. Müller D.R. de Beer T. Hess D. Meldal M. Richter W.J. Vliegenthart J.F.G. Hofsteenge J. Biochemistry. 1996; 35: 12005-12014Crossref PubMed Scopus (67) Google Scholar, 21.Diem S. Bergmann J. Herderich M. J. Agric. Food Chem. 2000; 48: 4913-4917Crossref PubMed Scopus (31) Google Scholar, 24.Becchi M. Fraisse D. Biomed. Environ. Mass Spectrom. 1989; 18: 122-130Crossref Scopus (90) Google Scholar, 25.Li Q.M. van den Heuvel H. Dillen L. Claeys M. Biol. Mass Spectrom. 1992; 21: 213-221Crossref Scopus (78) Google Scholar, 26.Prox A. Tetrahedron. 1968; 24: 3697-3700Crossref Scopus (59) Google Scholar). In comparison with the previously reported collision-induced dissociation fragmentation patterns of C-mannosylated peptides or glycosides, such as those of C-mannosylated peptides in RNase (2.Hofsteenge J. Muller D.R. de Beer T. Löffler A. Richter W.J. Vliegenthart J.F.G. Biochemistry. 1994; 33: 13524-13530Crossref PubMed Scopus (244) Google Scholar), flavone C-glycopyranoside (24.Becchi M. Fraisse D. Biomed. Environ. Mass Spectrom. 1989; 18: 122-130Crossref Scopus (90) Google Scholar, 25.Li Q.M. van den Heuvel H. Dillen L. Claeys M. Biol. Mass Spectrom. 1992; 21: 213-221Crossref Scopus (78) Google Scholar, 26.Prox A. Tetrahedron. 1968; 24: 3697-3700Crossref Scopus (59) Google Scholar), and tryptophan-N-glucoside in fruits (21.Diem S. Bergmann J. Herderich M. J. Agric. Food Chem. 2000; 48: 4913-4917Crossref PubMed Scopus (31) Google Scholar), the current results strongly suggest that the mannose is not C- but N-glycosidically linked to the indole ring of Trp residue, though the linkage conformation remains to be solved. A proposed structure of a Trp N-linked mannose in a CPO peptide is shown in Fig. 7. The release of mannosyl residue from the peptides following PNGase incubation provided additional data suggesting that the mannosyl residue is linked at the N-1 position of the Trp indole ring in these peptides. Moreover, when trypsin or Asp N-produced peptides of complements C7 and C8 (two C-mannosylated proteins) were treated with PNGase A or F, no change was observed from their C-mannosylated peptides (data not shown), which provided indirect evidence supporting the Trp N-mannosylation in CPO. This study has demonstrated that Trp residues in CPO undergo a novel type of glycosylation, N-mannosylation. In addition, both PNGase A and F are capable of hydrolyzing Trp N-linked mannose in peptides, suggesting that the amidase type of enzymes may be involved in the degradation of the Trp N-mannose complex in proteins. N-Mannosylation—An additional 162 Da higher than the calculated mass of the three CPO tryptic peptides (250VLEPAYEDGVWAPR263, 476INPHWDDER484, 778YDTVNLGLWR787) and the presence of the abundant hexose marker ion of m/z 163 in their MS/MS spectra provided the basis for suggesting that a hexose residue is associated with these tryptic peptides. The presence of the fragment with a loss of 348 Da (W + Hex), corresponding to each Trp residue position, indicated that the mannose is linked to the Trp residues in these peptides. To fully establish the linkage between the mannose and the Trp residue in CPO, it would be ideal to have the mannose-Trp complex or their peptides analyzed by NMR. Because of difficulties in obtaining enough CPO (<50 μg of CPO was purified from several thousand pairs of ovaries), it is impossible to perform such a structural characterization on mannosylated CPO peptides. However, the presence of the hexose marker ion of m/z 163 in the MS/MS spectra of the three CPO peptides and the ability to hydrolyze the covalently linked mannose from them by PNGase suggest that the mannose residue is linked at the N-1 position of Trp residue in the three peptides. Covalent linkage of a mannose to the Trp residues in proteins through the α-carbon of a mannose and the C-2 atom of the indole ring of Trp has been determined in a number of proteins (2.Hofsteenge J. Muller D.R. de Beer T. Löffler A. Richter W.J. Vliegenthart J.F.G. Biochemistry. 1994; 33: 13524-13530Crossref PubMed Scopus (244) Google Scholar, 3.De Beer T. Vliegenthart J.F.G. Löffler A. Hofsteenge J. Biochemistry. 1995; 34: 12005-12014Crossref PubMed Scopus (98) Google Scholar, 4.Löffler A. Doucey M.A. Jansson A.M. Müller D.R. de Beer T. Hess D. Meldal M. Richter W.J. Vliegenthart J.F.G. Hofsteenge J. Biochemistry. 1996; 35: 12005-12014Crossref PubMed Scopus (67) Google Scholar, 5.Krieg J. Glasner W. Vicentini A. Doucey M.A. Löffler A. Hess D. Hofsteenge J. J. Biol. Chem. 1997; 272: 26687-26692Abstract Full Text Full Text PDF PubMed Scopus (62) Google Scholar, 6.Krieg J. Hartmann S. Vicentini A. Glasner W. Hess D. Hofsteenge J. Mol. Biol. Cell. 1998; 9: 301-309Crossref PubMed Scopus (121) Google Scholar, 7.Doucey M.A. Hess D. Blommers M.J. Hofsteenge J. Glycobiology. 1999; 9: 435-441Crossref PubMed Scopus (80) Google Scholar, 8.Hofsteenge J. Blommers M. Hess D. Furmanek A. Miroshnichenko O. J. Biol. Chem. 1999; 274: 32786-32794Abstract Full Text Full Text PDF PubMed Scopus (96) Google Scholar, 9.Hartmann S. Hofsteenge J. J. Biol. Chem. 2000; 275: 28569-28574Abstract Full Text Full Text PDF PubMed Scopus (83) Google Scholar, 10.Gonzalez de Peredo A. Klein D. Macek B. Hess D. Peter-Katalinic J. Hofsteenge J. Mol. Cell. Proteomics. 2002; 1: 11-18Abstract Full Text Full Text PDF PubMed Scopus (102) Google Scholar, 11.Hofsteenge J. Huwiler K.G. Macek B. Hess D. Lawler J. Mosher D.F. Peter-Katalinic J. J. Biol. Chem. 2001; 276: 6485-6498Abstract Full Text Full Text PDF PubMed Scopus (211) Google Scholar, 13.Perez-Vilar J. Randell S.H. Boucher R.C. Glycobiology. 2004; 14: 325-337Crossref PubMed Scopus (87) Google Scholar, 14.Hilton D.J. Watowich S.S. Katz L. Lodish H.F. J. Biol. Chem. 1996; 271: 4699-4708Abstract Full Text Full Text PDF PubMed Scopus (102) Google Scholar, 15.Ihara Y. Manabe S. Kanda M. Kawano H. Nakayama T. Sekine I. Kondo T. Ito Y. Glycobiology. 2005; 15: 383-392Crossref PubMed Scopus (30) Google Scholar, 16.Ervin L.A. Ball L.E. Crouch R.K. Schey K.L. Investig. Ophthalmol. Vis. Sci. 2005; 46: 627-635Crossref PubMed Scopus (28) Google Scholar). Because of a C–C bond formation, this type of protein glycosylation has been termed protein C-mannosylation (2.Hofsteenge J. Muller D.R. de Beer T. Löffler A. Richter W.J. Vliegenthart J.F.G. Biochemistry. 1994; 33: 13524-13530Crossref PubMed Scopus (244) Google Scholar, 3.De Beer T. Vliegenthart J.F.G. Löffler A. Hofsteenge J. Biochemistry. 1995; 34: 12005-12014Crossref PubMed Scopus (98) Google Scholar, 4.Löffler A. Doucey M.A. Jansson A.M. Müller D.R. de Beer T. Hess D. Meldal M. Richter W.J. Vliegenthart J.F.G. Hofsteenge J. Biochemistry. 1996; 35: 12005-12014Crossref PubMed Scopus (67) Google Scholar). Because of difficulty in breaking the C–C bond at low energy collision-induced dissociation, the hexose marker ion of m/z 163 is absent in the MS/MS spectra of the Trp C-mannosylated peptides, but a dominant ion derived by a loss of 120 Da is typical for aromatic C-glycosides. Our initial suspicion was that the Trp mannosylation in CPO might be C-glycosidic linkage. However, careful examination of the MS/MS spectra of the mannose-containing CPO peptides, in comparison with the reported MS/MS spectra of the Trp C-mannosylated peptides in the literature (2.Hofsteenge J. Muller D.R. de Beer T. Löffler A. Richter W.J. Vliegenthart J.F.G. Biochemistry. 1994; 33: 13524-13530Crossref PubMed Scopus (244) Google Scholar, 3.De Beer T. Vliegenthart J.F.G. Löffler A. Hofsteenge J. Biochemistry. 1995; 34: 12005-12014Crossref PubMed Scopus (98) Google Scholar, 4.Löffler A. Doucey M.A. Jansson A.M. Müller D.R. de Beer T. Hess D. Meldal M. Richter W.J. Vliegenthart J.F.G. Hofsteenge J. Biochemistry. 1996; 35: 12005-12014Crossref PubMed Scopus (67) Google Scholar), clearly showed that the mannose was not linked at the C-2 position of Trp, because a loss of 120 Da was not observed in the MS/MS spectra of the three CPO peptides. The absence of [M + H - 120]+ ions in the MS/MS spectra of the Trp mannosylated peptides provides additional support for Trp N-mannosylation in CPO. PNGase-mediated Hydrolysis of N-Mannosyl Trp—The ability to hydrolyze the N-linked mannose by PNGase supports that the mannose is linked to the N-1 position of the Trp residues in CPO, but it also raises some critical questions regarding the biochemical mechanism leading to the hydrolysis of the N-linked mannose. Both PNGase A and F hydrolyze the β-amide bond of the asparagine side chain (see Fig. 8), and the sugar moiety seems to serve principally as substrate recognition, but no typical amide bond is present in the N-mannosyl Trp structure of the CPO peptides. Study of substrate specificity of PNGase A and F revealed that both enzymes can hydrolyze glycopeptides containing only a single GlcNAc or a glucose, the 2-acetamide group on the Asn-linked GlcNAc is important for substrate recognition, the length and nature of the peptides affect their hydrolysis, the consensus sequence (NX(S/T)) for N-glycosylation is not required by the enzymes, and both PNGase A and F cannot hydrolyze carbohydrate if linked to a single amino acid (27.Fan J.Q. Lee Y.C. J. Biol. Chem. 1997; 272: 27058-27064Abstract Full Text Full Text PDF PubMed Scopus (61) Google Scholar). Our result indicates that PNGase, as an amidase, may not have stringent selectivity for sugar structure. The 2-acetamide group on the GlcNAc may not be an absolute requirement for substrate recognition by PNGase. Our data provide clear evidence that PNGase is able to hydrolyze the N-linked mannose in CPO peptides, but its catalytic mechanism remains unknown and requires further experiments for elucidation. Possibility of Trp N-Mannosylation as a Common Post-translational Modification of Proteins—No reports have shown unambiguously Trp N-mannosylation in other proteins, so the detection of Trp N-mannosylation in CPO raises several critical questions, e.g. whether this new type of protein glycosylation is common in living organisms and what is the biochemical mechanism leading to the Trp N-mannosylation in proteins. Formation of N-mannosyl Trp proceeds under high acidic conditions at elevated temperature (22.Gutsche B. Grun C. Scheutzow D. Herderich M. Biochem. J. 1999; 343: 11-19Crossref PubMed Scopus (64) Google Scholar); consequently, one may ask if the N-linked mannose might be produced during CPO isolation. All buffers used for CPO purification were near neutral pH, and most of the purification procedures were conducted at 4 °C. Based on our experiment conditions and the specificity and extent of Trp N-mannosylation in the three CPO tryptic peptides, it is evident that Trp N-mannosylation is an apparent event of in vivo post-translational modifications. Therefore, it is reasonable to consider that Trp N-mannosylation in CPO is a consequence of a specific biological process instead of an artifact of sample preparation or other in vitro experimental factors. Accordingly, mosquitoes must have specific enzyme(s) catalyzing protein N-mannosylation reaction. If Trp N-mannosylation is an enzyme-mediated event, it is also reasonable to speculate that there should be other proteins undergoing Trp N-mannosylation in insects. An earlier report has indeed discussed the presence of a hexosyl Trp residue in an insect neuropeptide, but no definitive evidence was provided to identify its linkage nature (28.Gäde G. Kellner R. Rinehart K.L. Proefke M.L. Biochem. Biophysical Res. Comm. 1992; 189: 1303-1309Crossref PubMed Scopus (49) Google Scholar). Although techniques for glycoprotein analysis have been available, the requirement for a relatively large amount of starting material for elucidating the detailed structures of protein-associated sugars has often been the limiting factor. The technical progress in protein/peptide mass spectrometry, however, has made it possible to analyze extremely small amounts of protein sample, even though some of the protein modifications by glycosylation still could be easily overlooked. In our previous studies characterizing N-linked glycans in CPO (20.Li J.S. Li J. Protein Sci. 2005; 14: 2370-2386Crossref PubMed Scopus (5) Google Scholar), we determined its N-glycosylation site and glycan structures as well as its monosaccharide composition. Moreover, the study revealed that there is more mannose than that calculated based on the N-glycan structures. Our initial consideration was the presence of O-linked mannose in CPO. However, our present study led to the identification of Trp N-linked mannose at the Trp residues of the enzyme. Although the N-mannosylation appears to be an apparent post-translational modification in CPO, we certainly overlooked it in our previous study (20.Li J.S. Li J. Protein Sci. 2005; 14: 2370-2386Crossref PubMed Scopus (5) Google Scholar). Whether protein Trp N-mannosylation is restricted to insects or is a widespread phenomenon in higher eukaryotes remains to be determined. Potential Physiological Functions of the CPO N-Mannosylation— CPO is present in the chorion of Aedes aegypti eggs and plays a critical role during chorion hardening by catalyzing chorion protein cross-linking through dityrosine formation (12.Li J. Hodgeman B.A. Christensen B.M. Insect Biochem. Mol. Biol. 1996; 26: 309-317Crossref PubMed Scopus (82) Google Scholar, 18.Han Q. Li G. Li J. Arch. Biochem. Biophys. 2000; 378: 107-115Crossref PubMed Scopus (27) Google Scholar). Compared with other peroxidases, CPO is extremely resistant to some denaturing conditions. For example, CPO remains active for months in 1–5% SDS, but horseradish peroxidase completely lost its activity in 1% SDS after 2 h (18.Han Q. Li G. Li J. Arch. Biochem. Biophys. 2000; 378: 107-115Crossref PubMed Scopus (27) Google Scholar). The physical stability of the enzyme undoubtedly is intimately related to its intrinsic structure. After synthesis in follicle cells, CPO is secreted and assembled into a densely packed chorion layer. Although the results of this study did not provide evidence for the potential function of the N-linked mannose in CPO, it is reasonable to speculate that the Trp N-mannosylation might contribute to its physical stability or might be critical for its transportation and assembly into an intact chorion layer. In summary, we have identified a new type of linkage between carbohydrate moiety and protein involving the C–N bond that is formed between the anomeric carbon of a mannose residue and the N-1 atom at the indole ring of Trp residues in CPO. The most widely distributed N-glycosidic linkages not only occur at Asn residues but also at Trp residues of proteins. This is the first report that provides definitive evidence for N-mannosylation of the Trp residue in a protein, which should stimulate further research toward a comprehensive understanding of the physiology and biochemistry of Trp N-mannosylation in protein modifications. In addition, the PNGase-mediated cleavage of the mannosyl Trp residue in peptides is intriguing and deserves further investigation." @default.
• W2052519363 created "2016-06-24" @default.
• W2052519363 creator A5005484398 @default.
• W2052519363 creator A5009442138 @default.
• W2052519363 creator A5018502975 @default.
• W2052519363 creator A5040795581 @default.
• W2052519363 date "2005-11-01" @default.
• W2052519363 modified "2023-10-05" @default.
• W2052519363 title "Novel Glycosidic Linkage in Aedes aegypti Chorion Peroxidase" @default.
• W2052519363 cites W1964403279 @default.
• W2052519363 cites W1965294677 @default.
• W2052519363 cites W1983375595 @default.
• W2052519363 cites W1986942729 @default.
• W2052519363 cites W2004476663 @default.
• W2052519363 cites W2008380709 @default.
• W2052519363 cites W2015164963 @default.
• W2052519363 cites W2029028209 @default.
• W2052519363 cites W2034328738 @default.
• W2052519363 cites W2049637904 @default.
• W2052519363 cites W2050429474 @default.
• W2052519363 cites W2052149812 @default.
• W2052519363 cites W2057201333 @default.
• W2052519363 cites W2075902979 @default.
• W2052519363 cites W2084330255 @default.
• W2052519363 cites W2091538590 @default.
• W2052519363 cites W2092961880 @default.
• W2052519363 cites W2111410346 @default.
• W2052519363 cites W2115812653 @default.
• W2052519363 cites W2127272496 @default.
• W2052519363 cites W2141140189 @default.
• W2052519363 cites W2142968365 @default.
• W2052519363 cites W2146261527 @default.
• W2052519363 cites W2149480661 @default.
• W2052519363 cites W2153112938 @default.
• W2052519363 cites W2162807358 @default.
• W2052519363 cites W2170527772 @default.
• W2052519363 doi "https://doi.org/10.1074/jbc.m508449200" @default.
• W2052519363 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/16150691" @default.
• W2052519363 hasPublicationYear "2005" @default.
• W2052519363 type Work @default.
• W2052519363 sameAs 2052519363 @default.
• W2052519363 citedByCount "17" @default.
• W2052519363 countsByYear W20525193632012 @default.
• W2052519363 countsByYear W20525193632013 @default.
• W2052519363 countsByYear W20525193632014 @default.
• W2052519363 countsByYear W20525193632017 @default.
• W2052519363 countsByYear W20525193632021 @default.
• W2052519363 crossrefType "journal-article" @default.
• W2052519363 hasAuthorship W2052519363A5005484398 @default.
• W2052519363 hasAuthorship W2052519363A5009442138 @default.
• W2052519363 hasAuthorship W2052519363A5018502975 @default.
• W2052519363 hasAuthorship W2052519363A5040795581 @default.
• W2052519363 hasBestOaLocation W20525193631 @default.
• W2052519363 hasConcept C104317684 @default.
• W2052519363 hasConcept C150487720 @default.
• W2052519363 hasConcept C159047783 @default.
• W2052519363 hasConcept C162008176 @default.
• W2052519363 hasConcept C173758957 @default.
• W2052519363 hasConcept C181199279 @default.
• W2052519363 hasConcept C2777775583 @default.
• W2052519363 hasConcept C2780688631 @default.
• W2052519363 hasConcept C31266012 @default.
• W2052519363 hasConcept C533803919 @default.
• W2052519363 hasConcept C55493867 @default.
• W2052519363 hasConcept C59822182 @default.
• W2052519363 hasConcept C86803240 @default.
• W2052519363 hasConceptScore W2052519363C104317684 @default.
• W2052519363 hasConceptScore W2052519363C150487720 @default.
• W2052519363 hasConceptScore W2052519363C159047783 @default.
• W2052519363 hasConceptScore W2052519363C162008176 @default.
• W2052519363 hasConceptScore W2052519363C173758957 @default.
• W2052519363 hasConceptScore W2052519363C181199279 @default.
• W2052519363 hasConceptScore W2052519363C2777775583 @default.
• W2052519363 hasConceptScore W2052519363C2780688631 @default.
• W2052519363 hasConceptScore W2052519363C31266012 @default.
• W2052519363 hasConceptScore W2052519363C533803919 @default.
• W2052519363 hasConceptScore W2052519363C55493867 @default.
• W2052519363 hasConceptScore W2052519363C59822182 @default.
• W2052519363 hasConceptScore W2052519363C86803240 @default.
• W2052519363 hasIssue "46" @default.
• W2052519363 hasLocation W20525193631 @default.
• W2052519363 hasOpenAccess W2052519363 @default.
• W2052519363 hasPrimaryLocation W20525193631 @default.
• W2052519363 hasRelatedWork W1972212321 @default.
• W2052519363 hasRelatedWork W1975114493 @default.
• W2052519363 hasRelatedWork W1982434144 @default.
• W2052519363 hasRelatedWork W2090538202 @default.
• W2052519363 hasRelatedWork W2133250947 @default.
• W2052519363 hasRelatedWork W2148655086 @default.
• W2052519363 hasRelatedWork W2743258275 @default.
• W2052519363 hasRelatedWork W2767360610 @default.
• W2052519363 hasRelatedWork W4230390215 @default.
• W2052519363 hasRelatedWork W4307720133 @default.
• W2052519363 hasVolume "280" @default.
• W2052519363 isParatext "false" @default.
• W2052519363 isRetracted "false" @default.
• W2052519363 magId "2052519363" @default.
• W2052519363 workType "article" @default.