FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W2053409569> ?p ?o ?g. }

• W2053409569 abstract "Abstract Sex pheromone biosynthesis is induced in many moths by a neuropeptide, PBAN, consisting of 33-amino acid amidated at the C-terminus. The present study is concerned with cloning and characterizing the partial sequence of Hea-PBAN cDNA which is isolated from the brain and suboesophageal ganglion complex (Br-Sg) of Helicoverpa armigera adults. From the cDNA sequence, it can be predicted that the cDNA has a PBAN domain with 33 amino acids, LSDDMPATPADQEMYRQDPEQIDSRTKYFSPRL, with FSPRL amidated at the C-terminus. The amino acid sequence of predicted peptides including the PBAN, is identical to that of H. zea and H. assulta." @default.
• W2053409569 created "2016-06-24" @default.
• W2053409569 creator A5085272692 @default.
• W2053409569 date "1999-09-01" @default.
• W2053409569 modified "2023-09-27" @default.
• W2053409569 title "Identification and Determination of the Partial cDNA Encoding the Pheromone Biosynthesis Activating Neuropeptide in Helicoverpa armigera" @default.
• W2053409569 cites W1508719034 @default.
• W2053409569 cites W196650504 @default.
• W2053409569 cites W1970466173 @default.
• W2053409569 cites W1974251953 @default.
• W2053409569 cites W1985482054 @default.
• W2053409569 cites W1988920826 @default.
• W2053409569 cites W1989935433 @default.
• W2053409569 cites W1992013939 @default.
• W2053409569 cites W1999368540 @default.
• W2053409569 cites W2002903062 @default.
• W2053409569 cites W2009268565 @default.
• W2053409569 cites W2012216722 @default.
• W2053409569 cites W2016300244 @default.
• W2053409569 cites W2018096108 @default.
• W2053409569 cites W2019692168 @default.
• W2053409569 cites W2023482540 @default.
• W2053409569 cites W2026568376 @default.
• W2053409569 cites W2028944746 @default.
• W2053409569 cites W2029540081 @default.
• W2053409569 cites W2034053053 @default.
• W2053409569 cites W2044602725 @default.
• W2053409569 cites W2044982125 @default.
• W2053409569 cites W2052948825 @default.
• W2053409569 cites W2057456353 @default.
• W2053409569 cites W2058362541 @default.
• W2053409569 cites W2080209487 @default.
• W2053409569 cites W2083317983 @default.
• W2053409569 cites W2089547890 @default.
• W2053409569 cites W2135196412 @default.
• W2053409569 doi "https://doi.org/10.1016/s1226-8615(08)60047-3" @default.
• W2053409569 hasPublicationYear "1999" @default.
• W2053409569 type Work @default.
• W2053409569 sameAs 2053409569 @default.
• W2053409569 citedByCount "3" @default.
• W2053409569 crossrefType "journal-article" @default.
• W2053409569 hasAuthorship W2053409569A5085272692 @default.
• W2053409569 hasConcept C104317684 @default.
• W2053409569 hasConcept C118303440 @default.
• W2053409569 hasConcept C121050878 @default.
• W2053409569 hasConcept C134018914 @default.
• W2053409569 hasConcept C153911025 @default.
• W2053409569 hasConcept C167625842 @default.
• W2053409569 hasConcept C170493617 @default.
• W2053409569 hasConcept C173758957 @default.
• W2053409569 hasConcept C187882448 @default.
• W2053409569 hasConcept C199360897 @default.
• W2053409569 hasConcept C2776712339 @default.
• W2053409569 hasConcept C2778350275 @default.
• W2053409569 hasConcept C2779352202 @default.
• W2053409569 hasConcept C2781059250 @default.
• W2053409569 hasConcept C41008148 @default.
• W2053409569 hasConcept C515207424 @default.
• W2053409569 hasConcept C529278444 @default.
• W2053409569 hasConcept C553450214 @default.
• W2053409569 hasConcept C55493867 @default.
• W2053409569 hasConcept C59822182 @default.
• W2053409569 hasConcept C86803240 @default.
• W2053409569 hasConceptScore W2053409569C104317684 @default.
• W2053409569 hasConceptScore W2053409569C118303440 @default.
• W2053409569 hasConceptScore W2053409569C121050878 @default.
• W2053409569 hasConceptScore W2053409569C134018914 @default.
• W2053409569 hasConceptScore W2053409569C153911025 @default.
• W2053409569 hasConceptScore W2053409569C167625842 @default.
• W2053409569 hasConceptScore W2053409569C170493617 @default.
• W2053409569 hasConceptScore W2053409569C173758957 @default.
• W2053409569 hasConceptScore W2053409569C187882448 @default.
• W2053409569 hasConceptScore W2053409569C199360897 @default.
• W2053409569 hasConceptScore W2053409569C2776712339 @default.
• W2053409569 hasConceptScore W2053409569C2778350275 @default.
• W2053409569 hasConceptScore W2053409569C2779352202 @default.
• W2053409569 hasConceptScore W2053409569C2781059250 @default.
• W2053409569 hasConceptScore W2053409569C41008148 @default.
• W2053409569 hasConceptScore W2053409569C515207424 @default.
• W2053409569 hasConceptScore W2053409569C529278444 @default.
• W2053409569 hasConceptScore W2053409569C553450214 @default.
• W2053409569 hasConceptScore W2053409569C55493867 @default.
• W2053409569 hasConceptScore W2053409569C59822182 @default.
• W2053409569 hasConceptScore W2053409569C86803240 @default.
• W2053409569 hasLocation W20534095691 @default.
• W2053409569 hasOpenAccess W2053409569 @default.
• W2053409569 hasPrimaryLocation W20534095691 @default.
• W2053409569 hasRelatedWork W1508719034 @default.
• W2053409569 hasRelatedWork W1578771834 @default.
• W2053409569 hasRelatedWork W1970466173 @default.
• W2053409569 hasRelatedWork W1975873777 @default.
• W2053409569 hasRelatedWork W1984392344 @default.
• W2053409569 hasRelatedWork W1993100653 @default.
• W2053409569 hasRelatedWork W1998143156 @default.
• W2053409569 hasRelatedWork W1999368540 @default.
• W2053409569 hasRelatedWork W2008849603 @default.
• W2053409569 hasRelatedWork W2014283158 @default.
• W2053409569 hasRelatedWork W2018096108 @default.
• W2053409569 hasRelatedWork W2034053053 @default.
• W2053409569 hasRelatedWork W2058362541 @default.

• next