Matches in SemOpenAlex for { <https://semopenalex.org/work/W2054676786> ?p ?o ?g. }
Showing items 1 to 92 of
92
with 100 items per page.
- W2054676786 endingPage "827" @default.
- W2054676786 startingPage "826" @default.
- W2054676786 abstract "The pediocin-like antimicrobial peptide leucocin C produced by a strain of Leuconostoc mesenteroides has been purified using a recently developed rapid two-step procedure. The complete and corrected amino acid sequence of the peptide has been determined by Edman degradation of the intact peptide and a C-terminal fragment generated by cleavage with Asp-N endoprotease. Leucocin C contained 43 residues with the following sequence: KNYGNGVHCTKKGCSVDWGYAWTNIANNSVMNGLTGGNAGWHN. The molecular weight of leucocin C as determined by mass spectrometry was 4595, which is consistent with the theoretical molecular weight of 4596 calculated from the sequence. Moreover, the molecular weights of the two fragments generated by cleavage with Asp-N were also consistent with the determined sequence." @default.
- W2054676786 created "2016-06-24" @default.
- W2054676786 creator A5002271190 @default.
- W2054676786 creator A5016888452 @default.
- W2054676786 creator A5070544965 @default.
- W2054676786 date "2002-07-01" @default.
- W2054676786 modified "2023-09-23" @default.
- W2054676786 title "The complete amino acid sequence of the pediocin-like antimicrobial peptide leucocin C" @default.
- W2054676786 cites W1527928094 @default.
- W2054676786 cites W1989700815 @default.
- W2054676786 cites W2080518997 @default.
- W2054676786 cites W2115823505 @default.
- W2054676786 doi "https://doi.org/10.1016/s0006-291x(02)00769-6" @default.
- W2054676786 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/12127968" @default.
- W2054676786 hasPublicationYear "2002" @default.
- W2054676786 type Work @default.
- W2054676786 sameAs 2054676786 @default.
- W2054676786 citedByCount "35" @default.
- W2054676786 countsByYear W20546767862012 @default.
- W2054676786 countsByYear W20546767862013 @default.
- W2054676786 countsByYear W20546767862014 @default.
- W2054676786 countsByYear W20546767862015 @default.
- W2054676786 countsByYear W20546767862016 @default.
- W2054676786 countsByYear W20546767862021 @default.
- W2054676786 countsByYear W20546767862022 @default.
- W2054676786 countsByYear W20546767862023 @default.
- W2054676786 crossrefType "journal-article" @default.
- W2054676786 hasAuthorship W2054676786A5002271190 @default.
- W2054676786 hasAuthorship W2054676786A5016888452 @default.
- W2054676786 hasAuthorship W2054676786A5070544965 @default.
- W2054676786 hasConcept C100544194 @default.
- W2054676786 hasConcept C104317684 @default.
- W2054676786 hasConcept C151730666 @default.
- W2054676786 hasConcept C167625842 @default.
- W2054676786 hasConcept C175156509 @default.
- W2054676786 hasConcept C185592680 @default.
- W2054676786 hasConcept C2775920511 @default.
- W2054676786 hasConcept C2777957631 @default.
- W2054676786 hasConcept C2778112365 @default.
- W2054676786 hasConcept C2778859111 @default.
- W2054676786 hasConcept C2779281246 @default.
- W2054676786 hasConcept C2780206646 @default.
- W2054676786 hasConcept C43369102 @default.
- W2054676786 hasConcept C515207424 @default.
- W2054676786 hasConcept C523546767 @default.
- W2054676786 hasConcept C54355233 @default.
- W2054676786 hasConcept C55493867 @default.
- W2054676786 hasConcept C71240020 @default.
- W2054676786 hasConcept C86803240 @default.
- W2054676786 hasConcept C87933860 @default.
- W2054676786 hasConceptScore W2054676786C100544194 @default.
- W2054676786 hasConceptScore W2054676786C104317684 @default.
- W2054676786 hasConceptScore W2054676786C151730666 @default.
- W2054676786 hasConceptScore W2054676786C167625842 @default.
- W2054676786 hasConceptScore W2054676786C175156509 @default.
- W2054676786 hasConceptScore W2054676786C185592680 @default.
- W2054676786 hasConceptScore W2054676786C2775920511 @default.
- W2054676786 hasConceptScore W2054676786C2777957631 @default.
- W2054676786 hasConceptScore W2054676786C2778112365 @default.
- W2054676786 hasConceptScore W2054676786C2778859111 @default.
- W2054676786 hasConceptScore W2054676786C2779281246 @default.
- W2054676786 hasConceptScore W2054676786C2780206646 @default.
- W2054676786 hasConceptScore W2054676786C43369102 @default.
- W2054676786 hasConceptScore W2054676786C515207424 @default.
- W2054676786 hasConceptScore W2054676786C523546767 @default.
- W2054676786 hasConceptScore W2054676786C54355233 @default.
- W2054676786 hasConceptScore W2054676786C55493867 @default.
- W2054676786 hasConceptScore W2054676786C71240020 @default.
- W2054676786 hasConceptScore W2054676786C86803240 @default.
- W2054676786 hasConceptScore W2054676786C87933860 @default.
- W2054676786 hasIssue "4" @default.
- W2054676786 hasLocation W20546767861 @default.
- W2054676786 hasLocation W20546767862 @default.
- W2054676786 hasOpenAccess W2054676786 @default.
- W2054676786 hasPrimaryLocation W20546767861 @default.
- W2054676786 hasRelatedWork W2006599802 @default.
- W2054676786 hasRelatedWork W2016062340 @default.
- W2054676786 hasRelatedWork W2050580465 @default.
- W2054676786 hasRelatedWork W2054676786 @default.
- W2054676786 hasRelatedWork W2073199546 @default.
- W2054676786 hasRelatedWork W2073375101 @default.
- W2054676786 hasRelatedWork W2119986142 @default.
- W2054676786 hasRelatedWork W2329310416 @default.
- W2054676786 hasRelatedWork W3140121548 @default.
- W2054676786 hasRelatedWork W435495287 @default.
- W2054676786 hasVolume "295" @default.
- W2054676786 isParatext "false" @default.
- W2054676786 isRetracted "false" @default.
- W2054676786 magId "2054676786" @default.
- W2054676786 workType "article" @default.