FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W2056807898> ?p ?o ?g. }

• W2056807898 endingPage "1125" @default.
• W2056807898 startingPage "1114" @default.
• W2056807898 abstract "The complete amino acid sequence of the 125-residue photoactive yellow protein (PYP) from Ectothiorhodospira halophila has been determined to be MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKEVIGKNFFKDVAP CTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV. This is the first sequence to be reported for this class of proteins. There is no obvious sequence homology to any other protein, although the crystal structure, known at 2.4Åresolution (McRee, D.E., et al., 1989, Proc. Natl. Acad. Sci. USA 86, 6533-6537), indicates a relationship to the similarly sized fatty acid binding protein (FABP), a representative of a family of eukaryotic proteins that bind hydrophobic molecules. The amino acid sequence exhibits no greater similarity between PYP and FABP than for proteins chosen at random (8%). The photoactive yellow protein contains an unidentified chromophore that is bleached by light but recovers within a second. Here we demonstrate that the chromophore is bound covalently to Cys 69 instead of Lys 111 as deduced from the crystal structure analysis. The partially exposed side chains of Tyr 76, 94, and 118, plus Trp 119 appear to be arranged in a cluster and probably become more exposed due to a conformational change of the protein resulting from light-induced chromophore bleaching. The charged residues are not uniformly distributed on the protein surface but are arranged in positive and negative clusters on opposite sides of the protein. The exact chemical nature of the chromophore remains undetermined, but we here propose a possible structure based on precise mass analysis of a chromophore-binding peptide by electrospray ionization mass spectrometry and on the fact that the chromophore can be cleaved off the apoprotein upon reduction with a thiol reagent. The molecular mass of the chromophore, including an SH group, is 147.6 Da (+ 0.5 Da); the cysteine residue to which it is bound is at sequence position 69." @default.
• W2056807898 created "2016-06-24" @default.
• W2056807898 creator A5005253617 @default.
• W2056807898 creator A5022013143 @default.
• W2056807898 creator A5026427081 @default.
• W2056807898 creator A5027333163 @default.
• W2056807898 creator A5031224600 @default.
• W2056807898 creator A5041615481 @default.
• W2056807898 creator A5059566217 @default.
• W2056807898 creator A5068893642 @default.
• W2056807898 date "1993-07-01" @default.
• W2056807898 modified "2023-10-16" @default.
• W2056807898 title "Primary structure of a photoactive yellow protein from the phototrophic bacterium<i>Ectothiorhodospira halophila</i>, with evidence for the mass and the binding site of the chromophore" @default.
• W2056807898 cites W1221193043 @default.
• W2056807898 cites W1504859893 @default.
• W2056807898 cites W1519985762 @default.
• W2056807898 cites W1525745093 @default.
• W2056807898 cites W1530399082 @default.
• W2056807898 cites W1579322480 @default.
• W2056807898 cites W1645025205 @default.
• W2056807898 cites W1846076985 @default.
• W2056807898 cites W1883680853 @default.
• W2056807898 cites W1993929286 @default.
• W2056807898 cites W1994070552 @default.
• W2056807898 cites W2008839122 @default.
• W2056807898 cites W2014850677 @default.
• W2056807898 cites W2036940947 @default.
• W2056807898 cites W2044934841 @default.
• W2056807898 cites W2048816845 @default.
• W2056807898 cites W2051274488 @default.
• W2056807898 cites W2052656114 @default.
• W2056807898 cites W2052827870 @default.
• W2056807898 cites W2070075606 @default.
• W2056807898 cites W2080165605 @default.
• W2056807898 cites W2083652489 @default.
• W2056807898 cites W2087936718 @default.
• W2056807898 cites W2099334493 @default.
• W2056807898 cites W2103662266 @default.
• W2056807898 cites W2110810808 @default.
• W2056807898 cites W2115155685 @default.
• W2056807898 cites W2138473410 @default.
• W2056807898 cites W2145502155 @default.
• W2056807898 cites W2318584188 @default.
• W2056807898 cites W4248078228 @default.
• W2056807898 doi "https://doi.org/10.1002/pro.5560020706" @default.
• W2056807898 hasPubMedCentralId "https://www.ncbi.nlm.nih.gov/pmc/articles/2142427" @default.
• W2056807898 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/8358295" @default.
• W2056807898 hasPublicationYear "1993" @default.
• W2056807898 type Work @default.
• W2056807898 sameAs 2056807898 @default.
• W2056807898 citedByCount "70" @default.
• W2056807898 countsByYear W20568078982012 @default.
• W2056807898 countsByYear W20568078982013 @default.
• W2056807898 countsByYear W20568078982014 @default.
• W2056807898 countsByYear W20568078982015 @default.
• W2056807898 countsByYear W20568078982016 @default.
• W2056807898 countsByYear W20568078982017 @default.
• W2056807898 countsByYear W20568078982019 @default.
• W2056807898 countsByYear W20568078982020 @default.
• W2056807898 countsByYear W20568078982021 @default.
• W2056807898 countsByYear W20568078982022 @default.
• W2056807898 countsByYear W20568078982023 @default.
• W2056807898 crossrefType "journal-article" @default.
• W2056807898 hasAuthorship W2056807898A5005253617 @default.
• W2056807898 hasAuthorship W2056807898A5022013143 @default.
• W2056807898 hasAuthorship W2056807898A5026427081 @default.
• W2056807898 hasAuthorship W2056807898A5027333163 @default.
• W2056807898 hasAuthorship W2056807898A5031224600 @default.
• W2056807898 hasAuthorship W2056807898A5041615481 @default.
• W2056807898 hasAuthorship W2056807898A5059566217 @default.
• W2056807898 hasAuthorship W2056807898A5068893642 @default.
• W2056807898 hasBestOaLocation W20568078982 @default.
• W2056807898 hasConcept C104317684 @default.
• W2056807898 hasConcept C107824862 @default.
• W2056807898 hasConcept C167625842 @default.
• W2056807898 hasConcept C185592680 @default.
• W2056807898 hasConcept C192468462 @default.
• W2056807898 hasConcept C47701112 @default.
• W2056807898 hasConcept C55493867 @default.
• W2056807898 hasConcept C71240020 @default.
• W2056807898 hasConcept C75473681 @default.
• W2056807898 hasConcept C8010536 @default.
• W2056807898 hasConceptScore W2056807898C104317684 @default.
• W2056807898 hasConceptScore W2056807898C107824862 @default.
• W2056807898 hasConceptScore W2056807898C167625842 @default.
• W2056807898 hasConceptScore W2056807898C185592680 @default.
• W2056807898 hasConceptScore W2056807898C192468462 @default.
• W2056807898 hasConceptScore W2056807898C47701112 @default.
• W2056807898 hasConceptScore W2056807898C55493867 @default.
• W2056807898 hasConceptScore W2056807898C71240020 @default.
• W2056807898 hasConceptScore W2056807898C75473681 @default.
• W2056807898 hasConceptScore W2056807898C8010536 @default.
• W2056807898 hasIssue "7" @default.
• W2056807898 hasLocation W20568078981 @default.
• W2056807898 hasLocation W20568078982 @default.
• W2056807898 hasLocation W20568078983 @default.
• W2056807898 hasLocation W20568078984 @default.
• W2056807898 hasOpenAccess W2056807898 @default.

• next