FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W2058298095> ?p ?o ?g. }

• W2058298095 endingPage "5371" @default.
• W2058298095 startingPage "5364" @default.
• W2058298095 abstract "Two new conotoxins that affect both sodium and calcium currents have been characterized from the venom of Conus marmoreus, using direct assays on voltage-gated currents in caudodorsal neurons (CDC) of the freshwater snail Lymnaea stagnalis. The designations and amino acid sequences of the new toxins are MrVIA, ACRKKWEYCIVPIIGFIYCCPGLICGPFVCV, and MrVIB, ACSKKWEYCIVPILGFVYCCPGLICGPFVCV. Both toxins block voltage dependent sodium currents in snail neurons with ED50's of 0.1-0.2 microM. Effects are also observed on the fast-inactivating calcium current subtype in the CDC at > or = 1 microM. At concentrations of 1-5 microM, MrVIA acts as a calcium current agonist whereas MrVIB acts as a blocker. At higher doses both toxins block the fast-inactivating calcium current. Almost no effects of MrVIB are seen on the second (sustained kinetics) CDC calcium current subtype, while MrVIA also slightly blocks the sustained current. The calcium current block is rapidly reversible, whereas in contrast recovery of the sodium current requires extensive wash. MrVIA/B have the same cysteine framework as the omega- and delta-conotoxins and a high content of hydrophobic residues, in common with the delta-conotoxins. There is only one localized concentration of charged residues in MrVIA/B, in the first intercysteine loop. These two conotoxins provide unique probes for structure and function studies on voltage-gated sodium and L-type calcium channels. Their unusual cross-channel activity suggests they may represent an intermediate variant of conotoxin, in the diversification of one conotoxin structural family that selectively targets either sodium or calcium channels." @default.
• W2058298095 created "2016-06-24" @default.
• W2058298095 creator A5017109373 @default.
• W2058298095 creator A5022833979 @default.
• W2058298095 creator A5039982731 @default.
• W2058298095 creator A5049258301 @default.
• W2058298095 creator A5065355117 @default.
• W2058298095 creator A5075971695 @default.
• W2058298095 date "1995-04-25" @default.
• W2058298095 modified "2023-10-11" @default.
• W2058298095 title "New Sodium Channel-Blocking Conotoxins Also Affect Calcium Currents in Lymnaea Neurons" @default.
• W2058298095 cites W1424687720 @default.
• W2058298095 cites W1606166554 @default.
• W2058298095 cites W1775749144 @default.
• W2058298095 cites W1972934511 @default.
• W2058298095 cites W1979899788 @default.
• W2058298095 cites W1983687132 @default.
• W2058298095 cites W2002182615 @default.
• W2058298095 cites W2003918837 @default.
• W2058298095 cites W2013476871 @default.
• W2058298095 cites W2014019451 @default.
• W2058298095 cites W2014408719 @default.
• W2058298095 cites W2021963361 @default.
• W2058298095 cites W2023551620 @default.
• W2058298095 cites W2034332986 @default.
• W2058298095 cites W2034934110 @default.
• W2058298095 cites W2047819281 @default.
• W2058298095 cites W2078879206 @default.
• W2058298095 cites W2085819338 @default.
• W2058298095 cites W2087968966 @default.
• W2058298095 cites W2106341529 @default.
• W2058298095 cites W2118173900 @default.
• W2058298095 cites W2153090360 @default.
• W2058298095 cites W2169459792 @default.
• W2058298095 cites W59225307 @default.
• W2058298095 doi "https://doi.org/10.1021/bi00016a007" @default.
• W2058298095 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/7727394" @default.
• W2058298095 hasPublicationYear "1995" @default.
• W2058298095 type Work @default.
• W2058298095 sameAs 2058298095 @default.
• W2058298095 citedByCount "59" @default.
• W2058298095 countsByYear W20582980952012 @default.
• W2058298095 countsByYear W20582980952013 @default.
• W2058298095 countsByYear W20582980952014 @default.
• W2058298095 countsByYear W20582980952015 @default.
• W2058298095 countsByYear W20582980952016 @default.
• W2058298095 countsByYear W20582980952017 @default.
• W2058298095 countsByYear W20582980952019 @default.
• W2058298095 countsByYear W20582980952020 @default.
• W2058298095 countsByYear W20582980952021 @default.
• W2058298095 countsByYear W20582980952023 @default.
• W2058298095 crossrefType "journal-article" @default.
• W2058298095 hasAuthorship W2058298095A5017109373 @default.
• W2058298095 hasAuthorship W2058298095A5022833979 @default.
• W2058298095 hasAuthorship W2058298095A5039982731 @default.
• W2058298095 hasAuthorship W2058298095A5049258301 @default.
• W2058298095 hasAuthorship W2058298095A5065355117 @default.
• W2058298095 hasAuthorship W2058298095A5075971695 @default.
• W2058298095 hasConcept C12554922 @default.
• W2058298095 hasConcept C175234850 @default.
• W2058298095 hasConcept C178790620 @default.
• W2058298095 hasConcept C185592680 @default.
• W2058298095 hasConcept C18699975 @default.
• W2058298095 hasConcept C18903297 @default.
• W2058298095 hasConcept C2776286976 @default.
• W2058298095 hasConcept C2779448229 @default.
• W2058298095 hasConcept C2779965526 @default.
• W2058298095 hasConcept C50952357 @default.
• W2058298095 hasConcept C519063684 @default.
• W2058298095 hasConcept C537181965 @default.
• W2058298095 hasConcept C55493867 @default.
• W2058298095 hasConcept C85520022 @default.
• W2058298095 hasConcept C86803240 @default.
• W2058298095 hasConceptScore W2058298095C12554922 @default.
• W2058298095 hasConceptScore W2058298095C175234850 @default.
• W2058298095 hasConceptScore W2058298095C178790620 @default.
• W2058298095 hasConceptScore W2058298095C185592680 @default.
• W2058298095 hasConceptScore W2058298095C18699975 @default.
• W2058298095 hasConceptScore W2058298095C18903297 @default.
• W2058298095 hasConceptScore W2058298095C2776286976 @default.
• W2058298095 hasConceptScore W2058298095C2779448229 @default.
• W2058298095 hasConceptScore W2058298095C2779965526 @default.
• W2058298095 hasConceptScore W2058298095C50952357 @default.
• W2058298095 hasConceptScore W2058298095C519063684 @default.
• W2058298095 hasConceptScore W2058298095C537181965 @default.
• W2058298095 hasConceptScore W2058298095C55493867 @default.
• W2058298095 hasConceptScore W2058298095C85520022 @default.
• W2058298095 hasConceptScore W2058298095C86803240 @default.
• W2058298095 hasIssue "16" @default.
• W2058298095 hasLocation W20582980951 @default.
• W2058298095 hasLocation W20582980952 @default.
• W2058298095 hasOpenAccess W2058298095 @default.
• W2058298095 hasPrimaryLocation W20582980951 @default.
• W2058298095 hasRelatedWork W1988560686 @default.
• W2058298095 hasRelatedWork W2008076148 @default.
• W2058298095 hasRelatedWork W2025220571 @default.
• W2058298095 hasRelatedWork W2071151959 @default.
• W2058298095 hasRelatedWork W2082712980 @default.

• next