FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W2076172883> ?p ?o ?g. }

• W2076172883 endingPage "307" @default.
• W2076172883 startingPage "300" @default.
• W2076172883 abstract "The 34-residue peptide CTVAEIYLGNLAGADLILASGLPFWAITIANNFD (TM-34), corresponding to the 64-97 sequence of the rat bradykinin, receptor, was selected as a model of hydrophobic transmembrane peptide segment for systematic study of synthesis and purification strategies. Application of conventional Boc/Bzl chemistry resulted in very low yield of the synthesis (around 4%) when DMF was used as the solvent for coupling reactions. As shorter resin-bound fragments of TM-34 showed improved swelling in 80% NMP/DMSO, the synthesis was repeated in this mixed solvent and the yield increased to 12%. A comparative synthesis using optimized Fmoc chemistry and Fmoc-(FmocHmb) derivatives of Ala and Leu to prevent aggregation did not provide any detectable TM-34. Taken together, these results illustrate the synthetic problems associated with hydrophobic sequences, almost regardless of the chemistry used. As expected, the hydrophobicity of TM-34 and of most of its minor fragments made them scarcely soluble in common solvents. Purification could be achieved by loading the crude materials dissolved in 90% AcOH onto a C4 HPLC column and eluting with a TFA/MeCN linear gradient. CD studies of the TM-34 and of the shorter fragment with the 74-97 sequence (TM-24) showed a higher percentage of alpha-helix structure for the latter. This suggests that the shorter sequence may better represent the correct transmembrane region of the second helix of the rat bradykinin receptor." @default.
• W2076172883 created "2016-06-24" @default.
• W2076172883 creator A5010195419 @default.
• W2076172883 creator A5012472904 @default.
• W2076172883 creator A5013551382 @default.
• W2076172883 creator A5035036174 @default.
• W2076172883 creator A5073198053 @default.
• W2076172883 creator A5089979892 @default.
• W2076172883 creator A5091216330 @default.
• W2076172883 date "2009-01-12" @default.
• W2076172883 modified "2023-10-15" @default.
• W2076172883 title "Comparative evaluation of the synthesis and purification of transmembrane peptide fragments Rat bradykinin receptor fragment 64-97 as model" @default.
• W2076172883 cites W1972229214 @default.
• W2076172883 cites W1972658642 @default.
• W2076172883 cites W1984198411 @default.
• W2076172883 cites W1987049315 @default.
• W2076172883 cites W1987326122 @default.
• W2076172883 cites W1989452309 @default.
• W2076172883 cites W1995797614 @default.
• W2076172883 cites W2010954863 @default.
• W2076172883 cites W2012407162 @default.
• W2076172883 cites W2013813492 @default.
• W2076172883 cites W2027591090 @default.
• W2076172883 cites W2027929929 @default.
• W2076172883 cites W2037434015 @default.
• W2076172883 cites W2037455416 @default.
• W2076172883 cites W2040255016 @default.
• W2076172883 cites W2041808750 @default.
• W2076172883 cites W2056892513 @default.
• W2076172883 cites W2060579461 @default.
• W2076172883 cites W2066881069 @default.
• W2076172883 cites W2074042037 @default.
• W2076172883 cites W2080668690 @default.
• W2076172883 cites W2083916686 @default.
• W2076172883 cites W2084728430 @default.
• W2076172883 cites W2088266022 @default.
• W2076172883 cites W2116388838 @default.
• W2076172883 cites W2141112299 @default.
• W2076172883 cites W2334286314 @default.
• W2076172883 cites W2486022944 @default.
• W2076172883 cites W2489021144 @default.
• W2076172883 cites W2489256009 @default.
• W2076172883 cites W2494444130 @default.
• W2076172883 cites W2497356495 @default.
• W2076172883 cites W2922373147 @default.
• W2076172883 cites W334438110 @default.
• W2076172883 doi "https://doi.org/10.1111/j.1399-3011.1997.tb01130.x" @default.
• W2076172883 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/9176813" @default.
• W2076172883 hasPublicationYear "2009" @default.
• W2076172883 type Work @default.
• W2076172883 sameAs 2076172883 @default.
• W2076172883 citedByCount "16" @default.
• W2076172883 countsByYear W20761728832012 @default.
• W2076172883 countsByYear W20761728832013 @default.
• W2076172883 countsByYear W20761728832014 @default.
• W2076172883 countsByYear W20761728832015 @default.
• W2076172883 countsByYear W20761728832017 @default.
• W2076172883 countsByYear W20761728832018 @default.
• W2076172883 countsByYear W20761728832020 @default.
• W2076172883 crossrefType "journal-article" @default.
• W2076172883 hasAuthorship W2076172883A5010195419 @default.
• W2076172883 hasAuthorship W2076172883A5012472904 @default.
• W2076172883 hasAuthorship W2076172883A5013551382 @default.
• W2076172883 hasAuthorship W2076172883A5035036174 @default.
• W2076172883 hasAuthorship W2076172883A5073198053 @default.
• W2076172883 hasAuthorship W2076172883A5089979892 @default.
• W2076172883 hasAuthorship W2076172883A5091216330 @default.
• W2076172883 hasConcept C114373084 @default.
• W2076172883 hasConcept C118892022 @default.
• W2076172883 hasConcept C134121241 @default.
• W2076172883 hasConcept C170493617 @default.
• W2076172883 hasConcept C178790620 @default.
• W2076172883 hasConcept C185592680 @default.
• W2076172883 hasConcept C18903297 @default.
• W2076172883 hasConcept C191897082 @default.
• W2076172883 hasConcept C192562407 @default.
• W2076172883 hasConcept C202751555 @default.
• W2076172883 hasConcept C21951064 @default.
• W2076172883 hasConcept C24530287 @default.
• W2076172883 hasConcept C2778112365 @default.
• W2076172883 hasConcept C2778530040 @default.
• W2076172883 hasConcept C2779281246 @default.
• W2076172883 hasConcept C2779591629 @default.
• W2076172883 hasConcept C2779809887 @default.
• W2076172883 hasConcept C2779965526 @default.
• W2076172883 hasConcept C2780471494 @default.
• W2076172883 hasConcept C2781338088 @default.
• W2076172883 hasConcept C43617362 @default.
• W2076172883 hasConcept C55493867 @default.
• W2076172883 hasConcept C71240020 @default.
• W2076172883 hasConcept C86803240 @default.
• W2076172883 hasConceptScore W2076172883C114373084 @default.
• W2076172883 hasConceptScore W2076172883C118892022 @default.
• W2076172883 hasConceptScore W2076172883C134121241 @default.
• W2076172883 hasConceptScore W2076172883C170493617 @default.
• W2076172883 hasConceptScore W2076172883C178790620 @default.
• W2076172883 hasConceptScore W2076172883C185592680 @default.
• W2076172883 hasConceptScore W2076172883C18903297 @default.

• next