FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W2076247294> ?p ?o ?g. }

• W2076247294 endingPage "33982" @default.
• W2076247294 startingPage "33973" @default.
• W2076247294 abstract "Fucα1-6 oligosaccharide has a variety of biological functions and serves as a biomarker for hepatocellular carcinoma because of the elevated presence of fucosylated α-fetoprotein (AFP) in this type of cancer. In this study we purified a novel Fucα1-6-specific lectin from the mushroom Pholiota squarrosa by ion-exchange chromatography and affinity chromatography on thyroglobulin-agarose. The purified lectin was designated as PhoSL (P. squarrosa lectin). SDS-PAGE, MALDI-TOF mass spectrometry, and N-terminal amino acid sequencing indicate that PhoSL has a molecular mass of 4.5 kDa and consists of 40 amino acids (NH(2)-APVPVTKLVCDGDTYKCTAYLDFGDGRWVAQWDTNVFHTG-OH). Isoelectric focusing of the lectin showed bands near pI 4.0. The lectin activity was stable between pH 2.0 and 11.0 and at temperatures ranging from 0 to 100 °C for incubation times of 30 min. When PhoSL was investigated with frontal affinity chromatography using 132 pyridylaminated oligosaccharides, it was found that the lectin binds only to core α1-6-fucosylated N-glycans and not to other types of fucosylated oligosaccharides, such as α1-2-, α1-3-, and α1-4-fucosylated glycans. Furthermore, PhoSL bound to α1-6-fucosylated AFP but not to non-fucosylated AFP. In addition, PhoSL was able to demonstrate the differential expression of α1-6 fucosylation between primary and metastatic colon cancer tissues. Thus, PhoSL will be a promising tool for analyzing the biological functions of α1-6 fucosylation and evaluating Fucα1-6 oligosaccharides as cancer biomarkers." @default.
• W2076247294 created "2016-06-24" @default.
• W2076247294 creator A5002952594 @default.
• W2076247294 creator A5047938943 @default.
• W2076247294 creator A5049258575 @default.
• W2076247294 creator A5063321504 @default.
• W2076247294 creator A5078984314 @default.
• W2076247294 creator A5080209601 @default.
• W2076247294 creator A5080369708 @default.
• W2076247294 date "2012-10-01" @default.
• W2076247294 modified "2023-10-10" @default.
• W2076247294 title "A Novel Core Fucose-specific Lectin from the Mushroom Pholiota squarrosa" @default.
• W2076247294 cites W1497583526 @default.
• W2076247294 cites W1530723302 @default.
• W2076247294 cites W1569726016 @default.
• W2076247294 cites W1577314112 @default.
• W2076247294 cites W1584587121 @default.
• W2076247294 cites W1758850846 @default.
• W2076247294 cites W1965366080 @default.
• W2076247294 cites W1971504616 @default.
• W2076247294 cites W1977606211 @default.
• W2076247294 cites W1978970861 @default.
• W2076247294 cites W1995215898 @default.
• W2076247294 cites W1996794766 @default.
• W2076247294 cites W1999421234 @default.
• W2076247294 cites W2013256718 @default.
• W2076247294 cites W2017338209 @default.
• W2076247294 cites W2020647630 @default.
• W2076247294 cites W2032314146 @default.
• W2076247294 cites W2042784874 @default.
• W2076247294 cites W2047386852 @default.
• W2076247294 cites W2050204800 @default.
• W2076247294 cites W2050265442 @default.
• W2076247294 cites W2050717080 @default.
• W2076247294 cites W2050787746 @default.
• W2076247294 cites W2050862868 @default.
• W2076247294 cites W2056746886 @default.
• W2076247294 cites W2056812578 @default.
• W2076247294 cites W2057513763 @default.
• W2076247294 cites W2058569081 @default.
• W2076247294 cites W2058681712 @default.
• W2076247294 cites W2059799534 @default.
• W2076247294 cites W2061250593 @default.
• W2076247294 cites W2069373873 @default.
• W2076247294 cites W2070761199 @default.
• W2076247294 cites W2072167444 @default.
• W2076247294 cites W2072930531 @default.
• W2076247294 cites W2078869252 @default.
• W2076247294 cites W2083077313 @default.
• W2076247294 cites W2088631237 @default.
• W2076247294 cites W2089438534 @default.
• W2076247294 cites W2091851041 @default.
• W2076247294 cites W2100837269 @default.
• W2076247294 cites W2127073448 @default.
• W2076247294 cites W2132240438 @default.
• W2076247294 cites W2133936296 @default.
• W2076247294 cites W2135275878 @default.
• W2076247294 cites W2162847510 @default.
• W2076247294 cites W2162849337 @default.
• W2076247294 cites W2164979033 @default.
• W2076247294 cites W2166736542 @default.
• W2076247294 cites W4244338638 @default.
• W2076247294 cites W4293247451 @default.
• W2076247294 doi "https://doi.org/10.1074/jbc.m111.327692" @default.
• W2076247294 hasPubMedCentralId "https://www.ncbi.nlm.nih.gov/pmc/articles/3464508" @default.
• W2076247294 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/22872641" @default.
• W2076247294 hasPublicationYear "2012" @default.
• W2076247294 type Work @default.
• W2076247294 sameAs 2076247294 @default.
• W2076247294 citedByCount "95" @default.
• W2076247294 countsByYear W20762472942013 @default.
• W2076247294 countsByYear W20762472942014 @default.
• W2076247294 countsByYear W20762472942015 @default.
• W2076247294 countsByYear W20762472942016 @default.
• W2076247294 countsByYear W20762472942017 @default.
• W2076247294 countsByYear W20762472942018 @default.
• W2076247294 countsByYear W20762472942019 @default.
• W2076247294 countsByYear W20762472942020 @default.
• W2076247294 countsByYear W20762472942021 @default.
• W2076247294 countsByYear W20762472942022 @default.
• W2076247294 countsByYear W20762472942023 @default.
• W2076247294 crossrefType "journal-article" @default.
• W2076247294 hasAuthorship W2076247294A5002952594 @default.
• W2076247294 hasAuthorship W2076247294A5047938943 @default.
• W2076247294 hasAuthorship W2076247294A5049258575 @default.
• W2076247294 hasAuthorship W2076247294A5063321504 @default.
• W2076247294 hasAuthorship W2076247294A5078984314 @default.
• W2076247294 hasAuthorship W2076247294A5080209601 @default.
• W2076247294 hasAuthorship W2076247294A5080369708 @default.
• W2076247294 hasBestOaLocation W20762472941 @default.
• W2076247294 hasConcept C108625454 @default.
• W2076247294 hasConcept C153911025 @default.
• W2076247294 hasConcept C179247698 @default.
• W2076247294 hasConcept C181199279 @default.
• W2076247294 hasConcept C185592680 @default.
• W2076247294 hasConcept C206212055 @default.
• W2076247294 hasConcept C2776841590 @default.
• W2076247294 hasConcept C2779212266 @default.

• next