Matches in SemOpenAlex for { <https://semopenalex.org/work/W2079233530> ?p ?o ?g. }
- W2079233530 endingPage "370" @default.
- W2079233530 startingPage "362" @default.
- W2079233530 abstract "Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively." @default.
- W2079233530 created "2016-06-24" @default.
- W2079233530 creator A5000069575 @default.
- W2079233530 creator A5014883808 @default.
- W2079233530 creator A5022430715 @default.
- W2079233530 creator A5035036558 @default.
- W2079233530 creator A5042661254 @default.
- W2079233530 date "2006-02-01" @default.
- W2079233530 modified "2023-10-11" @default.
- W2079233530 title "Low molecular weight squash trypsin inhibitors from Sechium edule seeds" @default.
- W2079233530 cites W1461662986 @default.
- W2079233530 cites W1484115349 @default.
- W2079233530 cites W1494066298 @default.
- W2079233530 cites W1792177185 @default.
- W2079233530 cites W1966497279 @default.
- W2079233530 cites W1967647423 @default.
- W2079233530 cites W1972926169 @default.
- W2079233530 cites W1973419510 @default.
- W2079233530 cites W1985469117 @default.
- W2079233530 cites W2000905858 @default.
- W2079233530 cites W2003593019 @default.
- W2079233530 cites W2033159656 @default.
- W2079233530 cites W2035567217 @default.
- W2079233530 cites W2044005473 @default.
- W2079233530 cites W2047163586 @default.
- W2079233530 cites W2065864898 @default.
- W2079233530 cites W2067051080 @default.
- W2079233530 cites W2080786231 @default.
- W2079233530 cites W2081545117 @default.
- W2079233530 cites W2089615140 @default.
- W2079233530 cites W2102385058 @default.
- W2079233530 cites W2135737340 @default.
- W2079233530 cites W2140422547 @default.
- W2079233530 cites W2320952392 @default.
- W2079233530 cites W2323791199 @default.
- W2079233530 doi "https://doi.org/10.1016/j.phytochem.2005.11.016" @default.
- W2079233530 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/16406091" @default.
- W2079233530 hasPublicationYear "2006" @default.
- W2079233530 type Work @default.
- W2079233530 sameAs 2079233530 @default.
- W2079233530 citedByCount "10" @default.
- W2079233530 countsByYear W20792335302012 @default.
- W2079233530 countsByYear W20792335302015 @default.
- W2079233530 countsByYear W20792335302016 @default.
- W2079233530 countsByYear W20792335302019 @default.
- W2079233530 crossrefType "journal-article" @default.
- W2079233530 hasAuthorship W2079233530A5000069575 @default.
- W2079233530 hasAuthorship W2079233530A5014883808 @default.
- W2079233530 hasAuthorship W2079233530A5022430715 @default.
- W2079233530 hasAuthorship W2079233530A5035036558 @default.
- W2079233530 hasAuthorship W2079233530A5042661254 @default.
- W2079233530 hasConcept C104317684 @default.
- W2079233530 hasConcept C167625842 @default.
- W2079233530 hasConcept C181199279 @default.
- W2079233530 hasConcept C185592680 @default.
- W2079233530 hasConcept C193363816 @default.
- W2079233530 hasConcept C2780340462 @default.
- W2079233530 hasConcept C2781213060 @default.
- W2079233530 hasConcept C2781338088 @default.
- W2079233530 hasConcept C43617362 @default.
- W2079233530 hasConcept C55493867 @default.
- W2079233530 hasConcept C58121356 @default.
- W2079233530 hasConcept C71240020 @default.
- W2079233530 hasConcept C87933860 @default.
- W2079233530 hasConcept C97428945 @default.
- W2079233530 hasConceptScore W2079233530C104317684 @default.
- W2079233530 hasConceptScore W2079233530C167625842 @default.
- W2079233530 hasConceptScore W2079233530C181199279 @default.
- W2079233530 hasConceptScore W2079233530C185592680 @default.
- W2079233530 hasConceptScore W2079233530C193363816 @default.
- W2079233530 hasConceptScore W2079233530C2780340462 @default.
- W2079233530 hasConceptScore W2079233530C2781213060 @default.
- W2079233530 hasConceptScore W2079233530C2781338088 @default.
- W2079233530 hasConceptScore W2079233530C43617362 @default.
- W2079233530 hasConceptScore W2079233530C55493867 @default.
- W2079233530 hasConceptScore W2079233530C58121356 @default.
- W2079233530 hasConceptScore W2079233530C71240020 @default.
- W2079233530 hasConceptScore W2079233530C87933860 @default.
- W2079233530 hasConceptScore W2079233530C97428945 @default.
- W2079233530 hasIssue "4" @default.
- W2079233530 hasLocation W20792335301 @default.
- W2079233530 hasLocation W20792335302 @default.
- W2079233530 hasOpenAccess W2079233530 @default.
- W2079233530 hasPrimaryLocation W20792335301 @default.
- W2079233530 hasRelatedWork W1482938770 @default.
- W2079233530 hasRelatedWork W1901859711 @default.
- W2079233530 hasRelatedWork W1999281274 @default.
- W2079233530 hasRelatedWork W2017273187 @default.
- W2079233530 hasRelatedWork W2040379807 @default.
- W2079233530 hasRelatedWork W2049930593 @default.
- W2079233530 hasRelatedWork W2090888559 @default.
- W2079233530 hasRelatedWork W2091734543 @default.
- W2079233530 hasRelatedWork W2328635228 @default.
- W2079233530 hasRelatedWork W2338228183 @default.
- W2079233530 hasVolume "67" @default.
- W2079233530 isParatext "false" @default.
- W2079233530 isRetracted "false" @default.
- W2079233530 magId "2079233530" @default.