FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W226413691> ?p ?o ?g. }

• W226413691 endingPage "106" @default.
• W226413691 startingPage "98" @default.
• W226413691 abstract "In this study, we induced and purified a novel antimicrobial peptide exhibiting activity against Gram-positive bacteria from the immunized hemolymph of Hermetia illucens larvae. The immunized hemolymph was extracted, and the novel defensin-like peptide 4 (DLP4) was purified using solid-phase extraction and reverse-phase chromatography. The purified DLP4 demonstrated a molecular weight of 4267 Da, as determined using the matrix-assisted laser desorption/ionization–time-of-flight (MALDI–TOF) method. From analysis of DLP4 by N-terminal amino acid sequencing using Edman degradation, combined with MALDI–TOF and rapid amplification of cDNA ends–polymerase chain reaction (RACE–PCR), the amino acid sequence of the mature peptide was determined to be ATCDLLSPFKVGHAACAAHCIARGKRGGWCDKRAVCNCRK. In NCBI BLAST, the amino acid sequence of DPL4 was found to be 75% identical to the Phlebotomus duboscqi defensin. Analysis of the minimal inhibitory concentration (MIC) revealed that DLP4 have antibacterial effects against Gram-positive bacteria including methicillin-resistant Staphylococcus aureus (MRSA). The expression of DLP4 transcripts in several tissues after bacterial challenge was measured by quantitative real-time PCR. Expression of the DLP4 gene hardly occurred throughout the body before immunization, but was mostly evident in the fat body after immunization." @default.
• W226413691 created "2016-06-24" @default.
• W226413691 creator A5027051035 @default.
• W226413691 creator A5076432035 @default.
• W226413691 creator A5078242893 @default.
• W226413691 date "2015-09-01" @default.
• W226413691 modified "2023-10-02" @default.
• W226413691 title "Purification and characterization of a novel antibacterial peptide from black soldier fly (Hermetia illucens) larvae" @default.
• W226413691 cites W1479939900 @default.
• W226413691 cites W1511661421 @default.
• W226413691 cites W1574912127 @default.
• W226413691 cites W1963568761 @default.
• W226413691 cites W1968380572 @default.
• W226413691 cites W1969163610 @default.
• W226413691 cites W1969215918 @default.
• W226413691 cites W1993180650 @default.
• W226413691 cites W2003137341 @default.
• W226413691 cites W2003740601 @default.
• W226413691 cites W2009684818 @default.
• W226413691 cites W2009693677 @default.
• W226413691 cites W2018309785 @default.
• W226413691 cites W2025615821 @default.
• W226413691 cites W2038663802 @default.
• W226413691 cites W2054602599 @default.
• W226413691 cites W2055155126 @default.
• W226413691 cites W2057198053 @default.
• W226413691 cites W2074501836 @default.
• W226413691 cites W2082584405 @default.
• W226413691 cites W2089175291 @default.
• W226413691 cites W2093730621 @default.
• W226413691 cites W2094948602 @default.
• W226413691 cites W2106882534 @default.
• W226413691 cites W2107277218 @default.
• W226413691 cites W2110614991 @default.
• W226413691 cites W2118516269 @default.
• W226413691 cites W2124918733 @default.
• W226413691 cites W2130547103 @default.
• W226413691 cites W2138207315 @default.
• W226413691 cites W2142582413 @default.
• W226413691 cites W2147553685 @default.
• W226413691 cites W2150198659 @default.
• W226413691 cites W2154337154 @default.
• W226413691 cites W2162348455 @default.
• W226413691 cites W2171091522 @default.
• W226413691 cites W38787200 @default.
• W226413691 doi "https://doi.org/10.1016/j.dci.2015.04.018" @default.
• W226413691 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/25956195" @default.
• W226413691 hasPublicationYear "2015" @default.
• W226413691 type Work @default.
• W226413691 sameAs 226413691 @default.
• W226413691 citedByCount "126" @default.
• W226413691 countsByYear W2264136912015 @default.
• W226413691 countsByYear W2264136912016 @default.
• W226413691 countsByYear W2264136912017 @default.
• W226413691 countsByYear W2264136912018 @default.
• W226413691 countsByYear W2264136912019 @default.
• W226413691 countsByYear W2264136912020 @default.
• W226413691 countsByYear W2264136912021 @default.
• W226413691 countsByYear W2264136912022 @default.
• W226413691 countsByYear W2264136912023 @default.
• W226413691 crossrefType "journal-article" @default.
• W226413691 hasAuthorship W226413691A5027051035 @default.
• W226413691 hasAuthorship W226413691A5076432035 @default.
• W226413691 hasAuthorship W226413691A5078242893 @default.
• W226413691 hasConcept C100068826 @default.
• W226413691 hasConcept C104317684 @default.
• W226413691 hasConcept C153911025 @default.
• W226413691 hasConcept C167625842 @default.
• W226413691 hasConcept C173758957 @default.
• W226413691 hasConcept C187882448 @default.
• W226413691 hasConcept C2776498113 @default.
• W226413691 hasConcept C2777121799 @default.
• W226413691 hasConcept C2779281246 @default.
• W226413691 hasConcept C515207424 @default.
• W226413691 hasConcept C540938839 @default.
• W226413691 hasConcept C55493867 @default.
• W226413691 hasConcept C59822182 @default.
• W226413691 hasConcept C86803240 @default.
• W226413691 hasConcept C87933860 @default.
• W226413691 hasConcept C89423630 @default.
• W226413691 hasConceptScore W226413691C100068826 @default.
• W226413691 hasConceptScore W226413691C104317684 @default.
• W226413691 hasConceptScore W226413691C153911025 @default.
• W226413691 hasConceptScore W226413691C167625842 @default.
• W226413691 hasConceptScore W226413691C173758957 @default.
• W226413691 hasConceptScore W226413691C187882448 @default.
• W226413691 hasConceptScore W226413691C2776498113 @default.
• W226413691 hasConceptScore W226413691C2777121799 @default.
• W226413691 hasConceptScore W226413691C2779281246 @default.
• W226413691 hasConceptScore W226413691C515207424 @default.
• W226413691 hasConceptScore W226413691C540938839 @default.
• W226413691 hasConceptScore W226413691C55493867 @default.
• W226413691 hasConceptScore W226413691C59822182 @default.
• W226413691 hasConceptScore W226413691C86803240 @default.
• W226413691 hasConceptScore W226413691C87933860 @default.
• W226413691 hasConceptScore W226413691C89423630 @default.
• W226413691 hasFunder F4320321209 @default.
• W226413691 hasIssue "1" @default.

• next