Matches in SemOpenAlex for { <https://semopenalex.org/work/W2277584141> ?p ?o ?g. }
- W2277584141 abstract "Termicin is an antimicrobial peptide with six cysteines forming three disulfide bridges that was firstly isolated from the salivary glands and hemocytes of the termite Pseudacanthotermes spiniger. In contrast to many broad-spectrum antimicrobial peptides, termicin is most active against filamentous fungi. Although more than one hundred complementary DNAs (cDNAs) encoding termicin-like peptides have been reported to date, all these termicin-like peptides were obtained from Isoptera insects.The cDNA was cloned by combination of cDNA library construction kit and DNA sequencing. The polypeptide was purified by gel filtration and reversed-phase high performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined by Edman degradation and mass spectrometry. Antimicrobial activity was tested against several bacterial and fungal strains. The minimum inhibitory concentration (MIC) was determined by microdilution tests.A novel termicin-like peptide with primary structure ACDFQQCWVTCQRQYSINFISARCNGDSCVCTFRT was purified from extracts of the cockroach Eupolyphaga sinensis (Insecta: Blattodea). The cDNA encoding Es-termicin was cloned by cDNA library screening. This cDNA encoded a 60 amino acid precursor which included a 25 amino acid signal peptide. Amino acid sequence deduced from the cDNA matched well with the result of protein Edman degradation. Susceptibility test indicated that Es-termicin showed strong ability to kill fungi with a MIC of 25 μg/mL against Candida albicans ATCC 90028. It only showed limited potency to affect the growth of Gram-positive bacteria with a MIC of 200 μg/mL against Enterococcus faecalis ATCC 29212. It was inactive against gram-negative bacteria at the highest concentration tested (400 μg/mL). Es-termicin showed high sequence similarity with termicins from many species of termites (Insecta: Isoptera).This is the first report of a termicin-like peptide isolated from E. sinensis that belongs to the insect order Blattodea. Our results demonstrate the diversity of termicin-like peptides, as well as antimicrobial peptides in insects." @default.
- W2277584141 created "2016-06-24" @default.
- W2277584141 creator A5013192990 @default.
- W2277584141 creator A5013696865 @default.
- W2277584141 creator A5027458220 @default.
- W2277584141 creator A5044109718 @default.
- W2277584141 creator A5047737377 @default.
- W2277584141 creator A5063783723 @default.
- W2277584141 creator A5075313883 @default.
- W2277584141 date "2016-01-28" @default.
- W2277584141 modified "2023-09-25" @default.
- W2277584141 title "Cloning and purification of the first termicin-like peptide from the cockroach Eupolyphaga sinensis" @default.
- W2277584141 cites W1536605541 @default.
- W2277584141 cites W1963568761 @default.
- W2277584141 cites W1969810614 @default.
- W2277584141 cites W1970621669 @default.
- W2277584141 cites W1979005586 @default.
- W2277584141 cites W1984506933 @default.
- W2277584141 cites W1987129762 @default.
- W2277584141 cites W1992834190 @default.
- W2277584141 cites W2007436556 @default.
- W2277584141 cites W2032890728 @default.
- W2277584141 cites W2055807373 @default.
- W2277584141 cites W2063432901 @default.
- W2277584141 cites W2069444441 @default.
- W2277584141 cites W2074631110 @default.
- W2277584141 cites W2076687971 @default.
- W2277584141 cites W2082270598 @default.
- W2277584141 cites W2085493899 @default.
- W2277584141 cites W2091755943 @default.
- W2277584141 cites W2093730621 @default.
- W2277584141 cites W2094930350 @default.
- W2277584141 cites W2097099115 @default.
- W2277584141 cites W2104454585 @default.
- W2277584141 cites W2110071295 @default.
- W2277584141 cites W2152207030 @default.
- W2277584141 cites W2171265387 @default.
- W2277584141 cites W2171887339 @default.
- W2277584141 cites W2315753362 @default.
- W2277584141 cites W2415651539 @default.
- W2277584141 cites W2442068811 @default.
- W2277584141 cites W4322703239 @default.
- W2277584141 doi "https://doi.org/10.1186/s40409-016-0058-7" @default.
- W2277584141 hasPubMedCentralId "https://www.ncbi.nlm.nih.gov/pmc/articles/4730610" @default.
- W2277584141 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/26823660" @default.
- W2277584141 hasPublicationYear "2016" @default.
- W2277584141 type Work @default.
- W2277584141 sameAs 2277584141 @default.
- W2277584141 citedByCount "11" @default.
- W2277584141 countsByYear W22775841412016 @default.
- W2277584141 countsByYear W22775841412017 @default.
- W2277584141 countsByYear W22775841412018 @default.
- W2277584141 countsByYear W22775841412019 @default.
- W2277584141 countsByYear W22775841412021 @default.
- W2277584141 countsByYear W22775841412022 @default.
- W2277584141 countsByYear W22775841412023 @default.
- W2277584141 crossrefType "journal-article" @default.
- W2277584141 hasAuthorship W2277584141A5013192990 @default.
- W2277584141 hasAuthorship W2277584141A5013696865 @default.
- W2277584141 hasAuthorship W2277584141A5027458220 @default.
- W2277584141 hasAuthorship W2277584141A5044109718 @default.
- W2277584141 hasAuthorship W2277584141A5047737377 @default.
- W2277584141 hasAuthorship W2277584141A5063783723 @default.
- W2277584141 hasAuthorship W2277584141A5075313883 @default.
- W2277584141 hasBestOaLocation W22775841411 @default.
- W2277584141 hasConcept C104317684 @default.
- W2277584141 hasConcept C153911025 @default.
- W2277584141 hasConcept C167625842 @default.
- W2277584141 hasConcept C187882448 @default.
- W2277584141 hasConcept C189482833 @default.
- W2277584141 hasConcept C2779281246 @default.
- W2277584141 hasConcept C515207424 @default.
- W2277584141 hasConcept C523546767 @default.
- W2277584141 hasConcept C54355233 @default.
- W2277584141 hasConcept C55493867 @default.
- W2277584141 hasConcept C86803240 @default.
- W2277584141 hasConcept C87933860 @default.
- W2277584141 hasConceptScore W2277584141C104317684 @default.
- W2277584141 hasConceptScore W2277584141C153911025 @default.
- W2277584141 hasConceptScore W2277584141C167625842 @default.
- W2277584141 hasConceptScore W2277584141C187882448 @default.
- W2277584141 hasConceptScore W2277584141C189482833 @default.
- W2277584141 hasConceptScore W2277584141C2779281246 @default.
- W2277584141 hasConceptScore W2277584141C515207424 @default.
- W2277584141 hasConceptScore W2277584141C523546767 @default.
- W2277584141 hasConceptScore W2277584141C54355233 @default.
- W2277584141 hasConceptScore W2277584141C55493867 @default.
- W2277584141 hasConceptScore W2277584141C86803240 @default.
- W2277584141 hasConceptScore W2277584141C87933860 @default.
- W2277584141 hasIssue "1" @default.
- W2277584141 hasLocation W22775841411 @default.
- W2277584141 hasLocation W22775841412 @default.
- W2277584141 hasLocation W22775841413 @default.
- W2277584141 hasLocation W22775841414 @default.
- W2277584141 hasLocation W22775841415 @default.
- W2277584141 hasLocation W22775841416 @default.
- W2277584141 hasOpenAccess W2277584141 @default.
- W2277584141 hasPrimaryLocation W22775841411 @default.
- W2277584141 hasRelatedWork W1974283070 @default.
- W2277584141 hasRelatedWork W1991349199 @default.