Matches in SemOpenAlex for { <https://semopenalex.org/work/W2359835684> ?p ?o ?g. }
Showing items 1 to 69 of
69
with 100 items per page.
- W2359835684 endingPage "430" @default.
- W2359835684 startingPage "429" @default.
- W2359835684 abstract "AIM To synthesize fragments of inhibin subunits βB(1 28) (GLECDGRTNLC CRQQFFIDFRLIGWNDW), βB(85 115) (LSTMSMLYFDDEYNIVKRDVPNMIVEECGCA) and to obtain their monoclonal antibodies. METHODS Two segments of inhibin βB subunit were synthesized as semiantigens by solid phase peptide synthesis with Fmoc chemistry. These peptide products were conjugated with TG as antigens to prepare McAbs against inhibin βB subunit while EDC was coupling reagent. After immunization, fusion, selection and cloning procedures, 4 hybridoma cell lines were obtained. Ascites titer, specificity and relative affinity were identified. Four hybridoma cell lines were obtained through preparations of immunogens and monoclonal antibodies. The analysis of these McAbs indicated that they were highly special, sensitive and practical. The McAbs of inhibin α, βA and βB subunits were further purified. The immunohistochemistry in breast cancer was carried out with these three subunits′ McAbs. RESULTS The McAbs of inhibin βB subunit were highly sensitive, specific and useful. There was no notable divergence on the reactions of relative tumor tissues to the McAbs of inhibin α, βA and βB subunits in immunohistochemistry study. There was also almost the same positive ratio of the reaction of breast cancer tissues to these McAbs. CONCLUSION The method of detecting serum inhibin level will be established on the basis of present research." @default.
- W2359835684 created "2016-06-24" @default.
- W2359835684 creator A5077185189 @default.
- W2359835684 date "2000-06-01" @default.
- W2359835684 modified "2023-09-26" @default.
- W2359835684 title "SYNTHESIS OF HUMAN INHIBIN βA FRAGMENTS, PREPARATION AND GENERATION OF MONOCLONAL ANTIBODIES AGAINST HUMAN INHIBIN α AND βA SUBUNITS" @default.
- W2359835684 hasPublicationYear "2000" @default.
- W2359835684 type Work @default.
- W2359835684 sameAs 2359835684 @default.
- W2359835684 citedByCount "0" @default.
- W2359835684 crossrefType "journal-article" @default.
- W2359835684 hasAuthorship W2359835684A5077185189 @default.
- W2359835684 hasConcept C104292427 @default.
- W2359835684 hasConcept C104317684 @default.
- W2359835684 hasConcept C147483822 @default.
- W2359835684 hasConcept C153911025 @default.
- W2359835684 hasConcept C159654299 @default.
- W2359835684 hasConcept C185592680 @default.
- W2359835684 hasConcept C203014093 @default.
- W2359835684 hasConcept C204232928 @default.
- W2359835684 hasConcept C2779281246 @default.
- W2359835684 hasConcept C32611913 @default.
- W2359835684 hasConcept C542903549 @default.
- W2359835684 hasConcept C55493867 @default.
- W2359835684 hasConcept C86803240 @default.
- W2359835684 hasConceptScore W2359835684C104292427 @default.
- W2359835684 hasConceptScore W2359835684C104317684 @default.
- W2359835684 hasConceptScore W2359835684C147483822 @default.
- W2359835684 hasConceptScore W2359835684C153911025 @default.
- W2359835684 hasConceptScore W2359835684C159654299 @default.
- W2359835684 hasConceptScore W2359835684C185592680 @default.
- W2359835684 hasConceptScore W2359835684C203014093 @default.
- W2359835684 hasConceptScore W2359835684C204232928 @default.
- W2359835684 hasConceptScore W2359835684C2779281246 @default.
- W2359835684 hasConceptScore W2359835684C32611913 @default.
- W2359835684 hasConceptScore W2359835684C542903549 @default.
- W2359835684 hasConceptScore W2359835684C55493867 @default.
- W2359835684 hasConceptScore W2359835684C86803240 @default.
- W2359835684 hasIssue "6" @default.
- W2359835684 hasLocation W23598356841 @default.
- W2359835684 hasOpenAccess W2359835684 @default.
- W2359835684 hasPrimaryLocation W23598356841 @default.
- W2359835684 hasRelatedWork W1841034905 @default.
- W2359835684 hasRelatedWork W1849752772 @default.
- W2359835684 hasRelatedWork W1966783413 @default.
- W2359835684 hasRelatedWork W2005514574 @default.
- W2359835684 hasRelatedWork W2011112741 @default.
- W2359835684 hasRelatedWork W2015606664 @default.
- W2359835684 hasRelatedWork W2018497979 @default.
- W2359835684 hasRelatedWork W2038406628 @default.
- W2359835684 hasRelatedWork W2039123443 @default.
- W2359835684 hasRelatedWork W2055934059 @default.
- W2359835684 hasRelatedWork W2059923082 @default.
- W2359835684 hasRelatedWork W2062398436 @default.
- W2359835684 hasRelatedWork W2064541028 @default.
- W2359835684 hasRelatedWork W2364404337 @default.
- W2359835684 hasRelatedWork W2378328551 @default.
- W2359835684 hasRelatedWork W2416313866 @default.
- W2359835684 hasRelatedWork W2461912812 @default.
- W2359835684 hasRelatedWork W367991534 @default.
- W2359835684 hasRelatedWork W1929147813 @default.
- W2359835684 hasRelatedWork W2846696313 @default.
- W2359835684 hasVolume "35" @default.
- W2359835684 isParatext "false" @default.
- W2359835684 isRetracted "false" @default.
- W2359835684 magId "2359835684" @default.
- W2359835684 workType "article" @default.