FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W2521749002> ?p ?o ?g. }

• W2521749002 endingPage "682" @default.
• W2521749002 startingPage "677" @default.
• W2521749002 abstract "The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, ResourceTM S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation." @default.
• W2521749002 created "2016-09-30" @default.
• W2521749002 creator A5004110391 @default.
• W2521749002 creator A5010238428 @default.
• W2521749002 creator A5037458498 @default.
• W2521749002 creator A5042153131 @default.
• W2521749002 creator A5053882773 @default.
• W2521749002 creator A5065343633 @default.
• W2521749002 creator A5081025927 @default.
• W2521749002 date "2016-09-01" @default.
• W2521749002 modified "2023-10-18" @default.
• W2521749002 title "Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris" @default.
• W2521749002 cites W108782207 @default.
• W2521749002 cites W1509187363 @default.
• W2521749002 cites W1933947620 @default.
• W2521749002 cites W1963891097 @default.
• W2521749002 cites W1966674139 @default.
• W2521749002 cites W2001651711 @default.
• W2521749002 cites W2003392774 @default.
• W2521749002 cites W2008737751 @default.
• W2521749002 cites W2011706236 @default.
• W2521749002 cites W2025432133 @default.
• W2521749002 cites W2027990520 @default.
• W2521749002 cites W2033636981 @default.
• W2521749002 cites W2043979631 @default.
• W2521749002 cites W2068432930 @default.
• W2521749002 cites W2096213888 @default.
• W2521749002 cites W2145826454 @default.
• W2521749002 cites W2153097152 @default.
• W2521749002 cites W2156161328 @default.
• W2521749002 cites W2208300207 @default.
• W2521749002 cites W2398937841 @default.
• W2521749002 cites W2409574186 @default.
• W2521749002 doi "https://doi.org/10.1016/s1875-5364(16)30080-2" @default.
• W2521749002 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/27667513" @default.
• W2521749002 hasPublicationYear "2016" @default.
• W2521749002 type Work @default.
• W2521749002 sameAs 2521749002 @default.
• W2521749002 citedByCount "7" @default.
• W2521749002 countsByYear W25217490022017 @default.
• W2521749002 countsByYear W25217490022018 @default.
• W2521749002 countsByYear W25217490022019 @default.
• W2521749002 countsByYear W25217490022021 @default.
• W2521749002 countsByYear W25217490022023 @default.
• W2521749002 crossrefType "journal-article" @default.
• W2521749002 hasAuthorship W2521749002A5004110391 @default.
• W2521749002 hasAuthorship W2521749002A5010238428 @default.
• W2521749002 hasAuthorship W2521749002A5037458498 @default.
• W2521749002 hasAuthorship W2521749002A5042153131 @default.
• W2521749002 hasAuthorship W2521749002A5053882773 @default.
• W2521749002 hasAuthorship W2521749002A5065343633 @default.
• W2521749002 hasAuthorship W2521749002A5081025927 @default.
• W2521749002 hasBestOaLocation W25217490021 @default.
• W2521749002 hasConcept C104317684 @default.
• W2521749002 hasConcept C118303440 @default.
• W2521749002 hasConcept C136764020 @default.
• W2521749002 hasConcept C153911025 @default.
• W2521749002 hasConcept C167625842 @default.
• W2521749002 hasConcept C170493617 @default.
• W2521749002 hasConcept C180746962 @default.
• W2521749002 hasConcept C185592680 @default.
• W2521749002 hasConcept C2778937882 @default.
• W2521749002 hasConcept C41008148 @default.
• W2521749002 hasConcept C55493867 @default.
• W2521749002 hasConcept C86803240 @default.
• W2521749002 hasConcept C87933860 @default.
• W2521749002 hasConceptScore W2521749002C104317684 @default.
• W2521749002 hasConceptScore W2521749002C118303440 @default.
• W2521749002 hasConceptScore W2521749002C136764020 @default.
• W2521749002 hasConceptScore W2521749002C153911025 @default.
• W2521749002 hasConceptScore W2521749002C167625842 @default.
• W2521749002 hasConceptScore W2521749002C170493617 @default.
• W2521749002 hasConceptScore W2521749002C180746962 @default.
• W2521749002 hasConceptScore W2521749002C185592680 @default.
• W2521749002 hasConceptScore W2521749002C2778937882 @default.
• W2521749002 hasConceptScore W2521749002C41008148 @default.
• W2521749002 hasConceptScore W2521749002C55493867 @default.
• W2521749002 hasConceptScore W2521749002C86803240 @default.
• W2521749002 hasConceptScore W2521749002C87933860 @default.
• W2521749002 hasFunder F4320321001 @default.
• W2521749002 hasFunder F4320322108 @default.
• W2521749002 hasFunder F4320323193 @default.
• W2521749002 hasIssue "9" @default.
• W2521749002 hasLocation W25217490021 @default.
• W2521749002 hasLocation W25217490022 @default.
• W2521749002 hasOpenAccess W2521749002 @default.
• W2521749002 hasPrimaryLocation W25217490021 @default.
• W2521749002 hasRelatedWork W1566807875 @default.
• W2521749002 hasRelatedWork W1966851885 @default.
• W2521749002 hasRelatedWork W2036027922 @default.
• W2521749002 hasRelatedWork W2062928754 @default.
• W2521749002 hasRelatedWork W2085736981 @default.
• W2521749002 hasRelatedWork W2521749002 @default.
• W2521749002 hasRelatedWork W2588700697 @default.
• W2521749002 hasRelatedWork W2886350882 @default.
• W2521749002 hasRelatedWork W3147699195 @default.
• W2521749002 hasRelatedWork W3180726683 @default.
• W2521749002 hasVolume "14" @default.

• next