FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W2801096568> ?p ?o ?g. }

• W2801096568 endingPage "131" @default.
• W2801096568 startingPage "127" @default.
• W2801096568 abstract "Agonists and antagonists for galanin receptor subtypes GalR1-3 can be used as putative therapeutics targets for the treatment of various human diseases. However, effects of galanin and its N-terminal fragments on myocardial ischemia/reperfusion injury remain unclear. This study was designed to assess the ability of the full-length galanin (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, G1), the natural fragments WTLNSAGYLL-NH2 (G2) and WTLNSAGYLLGPHA (G3), and their modified analogs WTLNAAGYLL (G4) and WTLNSAGYLLGPβAH (G5) to limit acute myocardial infarction in rats in vivo. The peptides G2-5 were synthesized by the automatic solid phase method using Fmoc technology, purified by preparative HPLC and identified by 1H NMR spectroscopy and MALDI -TOF mass spectrometry. The peptides G1-5 were administered by i.v. bolus injection at the onset of reperfusion at doses of 0.25, 0.50, 1.0, 2.0 or 3.0 mg/kg. The optimal doses of the peptides G1-5 significantly reduced the infarction area and decreased the activity of CK-MB and LDH in blood plasma at the end of reperfusion compared with the control. Among the peptides studied, G5 showed high efficacy in reducing the infarct size and the activity of necrosis markers in blood plasma with no significant effect on hemodynamic parameters. The results suggest that a novel agonist for galanin receptors G5 may be a promising tool for the treatment of myocardial ischemia/reperfusion (I/R) injury. Further studies are warranted to explore the stability of this peptide in blood plasma and mechanisms that contribute to its cardioprotective effects." @default.
• W2801096568 created "2018-05-17" @default.
• W2801096568 creator A5000695890 @default.
• W2801096568 creator A5013740551 @default.
• W2801096568 creator A5039061375 @default.
• W2801096568 creator A5042835630 @default.
• W2801096568 creator A5044738313 @default.
• W2801096568 creator A5055564794 @default.
• W2801096568 creator A5060043444 @default.
• W2801096568 creator A5074381984 @default.
• W2801096568 creator A5084982997 @default.
• W2801096568 date "2019-01-01" @default.
• W2801096568 modified "2023-10-17" @default.
• W2801096568 title "Galanin and its N-terminal fragments reduce acute myocardial infarction in rats" @default.
• W2801096568 cites W1170028849 @default.
• W2801096568 cites W1575263278 @default.
• W2801096568 cites W1963842582 @default.
• W2801096568 cites W1981329238 @default.
• W2801096568 cites W1986608344 @default.
• W2801096568 cites W1988184759 @default.
• W2801096568 cites W1989854598 @default.
• W2801096568 cites W1996704811 @default.
• W2801096568 cites W2001607934 @default.
• W2801096568 cites W2009232050 @default.
• W2801096568 cites W2011710545 @default.
• W2801096568 cites W2017165839 @default.
• W2801096568 cites W2019684500 @default.
• W2801096568 cites W2020167823 @default.
• W2801096568 cites W2021650594 @default.
• W2801096568 cites W2022264176 @default.
• W2801096568 cites W2026208431 @default.
• W2801096568 cites W2047899129 @default.
• W2801096568 cites W2055832548 @default.
• W2801096568 cites W2060856987 @default.
• W2801096568 cites W2063436993 @default.
• W2801096568 cites W2089480305 @default.
• W2801096568 cites W2091416775 @default.
• W2801096568 cites W2159189181 @default.
• W2801096568 cites W2334701308 @default.
• W2801096568 cites W2509334952 @default.
• W2801096568 cites W2585403031 @default.
• W2801096568 cites W2762110189 @default.
• W2801096568 doi "https://doi.org/10.1016/j.peptides.2018.05.001" @default.
• W2801096568 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/29730241" @default.
• W2801096568 hasPublicationYear "2019" @default.
• W2801096568 type Work @default.
• W2801096568 sameAs 2801096568 @default.
• W2801096568 citedByCount "11" @default.
• W2801096568 countsByYear W28010965682018 @default.
• W2801096568 countsByYear W28010965682019 @default.
• W2801096568 countsByYear W28010965682021 @default.
• W2801096568 countsByYear W28010965682022 @default.
• W2801096568 countsByYear W28010965682023 @default.
• W2801096568 crossrefType "journal-article" @default.
• W2801096568 hasAuthorship W2801096568A5000695890 @default.
• W2801096568 hasAuthorship W2801096568A5013740551 @default.
• W2801096568 hasAuthorship W2801096568A5039061375 @default.
• W2801096568 hasAuthorship W2801096568A5042835630 @default.
• W2801096568 hasAuthorship W2801096568A5044738313 @default.
• W2801096568 hasAuthorship W2801096568A5055564794 @default.
• W2801096568 hasAuthorship W2801096568A5060043444 @default.
• W2801096568 hasAuthorship W2801096568A5074381984 @default.
• W2801096568 hasAuthorship W2801096568A5084982997 @default.
• W2801096568 hasConcept C118303440 @default.
• W2801096568 hasConcept C126322002 @default.
• W2801096568 hasConcept C134018914 @default.
• W2801096568 hasConcept C150903083 @default.
• W2801096568 hasConcept C170493617 @default.
• W2801096568 hasConcept C185592680 @default.
• W2801096568 hasConcept C19519825 @default.
• W2801096568 hasConcept C207001950 @default.
• W2801096568 hasConcept C2777798775 @default.
• W2801096568 hasConcept C2778938600 @default.
• W2801096568 hasConcept C2779281246 @default.
• W2801096568 hasConcept C2780114680 @default.
• W2801096568 hasConcept C43376680 @default.
• W2801096568 hasConcept C500558357 @default.
• W2801096568 hasConcept C541997718 @default.
• W2801096568 hasConcept C55493867 @default.
• W2801096568 hasConcept C71924100 @default.
• W2801096568 hasConcept C86803240 @default.
• W2801096568 hasConcept C98274493 @default.
• W2801096568 hasConceptScore W2801096568C118303440 @default.
• W2801096568 hasConceptScore W2801096568C126322002 @default.
• W2801096568 hasConceptScore W2801096568C134018914 @default.
• W2801096568 hasConceptScore W2801096568C150903083 @default.
• W2801096568 hasConceptScore W2801096568C170493617 @default.
• W2801096568 hasConceptScore W2801096568C185592680 @default.
• W2801096568 hasConceptScore W2801096568C19519825 @default.
• W2801096568 hasConceptScore W2801096568C207001950 @default.
• W2801096568 hasConceptScore W2801096568C2777798775 @default.
• W2801096568 hasConceptScore W2801096568C2778938600 @default.
• W2801096568 hasConceptScore W2801096568C2779281246 @default.
• W2801096568 hasConceptScore W2801096568C2780114680 @default.
• W2801096568 hasConceptScore W2801096568C43376680 @default.
• W2801096568 hasConceptScore W2801096568C500558357 @default.
• W2801096568 hasConceptScore W2801096568C541997718 @default.
• W2801096568 hasConceptScore W2801096568C55493867 @default.

• next