Matches in SemOpenAlex for { <https://semopenalex.org/work/W2989062779> ?p ?o ?g. }
- W2989062779 endingPage "332" @default.
- W2989062779 startingPage "322" @default.
- W2989062779 abstract "In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta potential, ellipsometry, and circular dichroism spectroscopy (CD) experiments were employed to investigate the relative importance of membrane interactions of peptide-loaded microgel particles and of released peptide. For the free peptide, NR results showed membrane binding occurring preferentially in the tail region in a concentration-dependent manner. At low peptide concentration (0.3 μM) only peptide insertion in the outer leaflet was seen, however, pronounced membrane defects and peptide present in both leaflets was observed at higher peptide concentration (5.0 μM). LL-37 loaded into MAA microgels qualitatively mirrored these effects regarding both peptide localization within the membrane and concentration-dependent defect formation. In addition, very limited membrane binding of microgel particles was observed, in agreement with FTIR-ATR and liposome leakage results. FTIR-ATR showed LL-37 to undergo α-helix formation on membrane insertion, also supported by CD results, the kinetics of which was substantially reduced for microgel-loaded LL-37 due to sustained peptide release. Together, these findings demonstrate that membrane interactions for microgel-loaded LL-37 are dominated by released peptide, but also that slow release of microgel-loaded LL-37 translates into kinetic effects on peptide-membrane interactions, relating to both peptide localization within the bilayer, and to bilayer structure." @default.
- W2989062779 created "2019-11-22" @default.
- W2989062779 creator A5002914756 @default.
- W2989062779 creator A5018101817 @default.
- W2989062779 creator A5020642110 @default.
- W2989062779 creator A5023762311 @default.
- W2989062779 creator A5028001366 @default.
- W2989062779 creator A5038803345 @default.
- W2989062779 creator A5080053429 @default.
- W2989062779 creator A5082060907 @default.
- W2989062779 creator A5084638950 @default.
- W2989062779 date "2020-03-01" @default.
- W2989062779 modified "2023-10-06" @default.
- W2989062779 title "Membrane interactions of antimicrobial peptide-loaded microgels" @default.
- W2989062779 cites W1967170412 @default.
- W2989062779 cites W1970503287 @default.
- W2989062779 cites W1974768174 @default.
- W2989062779 cites W1980326925 @default.
- W2989062779 cites W1980675523 @default.
- W2989062779 cites W1983439719 @default.
- W2989062779 cites W1989998611 @default.
- W2989062779 cites W1997152791 @default.
- W2989062779 cites W2000431734 @default.
- W2989062779 cites W2017041065 @default.
- W2989062779 cites W2020154280 @default.
- W2989062779 cites W2021628803 @default.
- W2989062779 cites W2028122134 @default.
- W2989062779 cites W2029213325 @default.
- W2989062779 cites W2045897279 @default.
- W2989062779 cites W2054878643 @default.
- W2989062779 cites W2056158724 @default.
- W2989062779 cites W2057653477 @default.
- W2989062779 cites W2060529580 @default.
- W2989062779 cites W2063116767 @default.
- W2989062779 cites W2066943809 @default.
- W2989062779 cites W2067420458 @default.
- W2989062779 cites W2072476846 @default.
- W2989062779 cites W2072777333 @default.
- W2989062779 cites W2077378839 @default.
- W2989062779 cites W2077706053 @default.
- W2989062779 cites W2084871837 @default.
- W2989062779 cites W2086529087 @default.
- W2989062779 cites W2087289102 @default.
- W2989062779 cites W2097099115 @default.
- W2989062779 cites W2098786490 @default.
- W2989062779 cites W2104772210 @default.
- W2989062779 cites W2114526613 @default.
- W2989062779 cites W2120569780 @default.
- W2989062779 cites W2123570629 @default.
- W2989062779 cites W2137951663 @default.
- W2989062779 cites W2139652091 @default.
- W2989062779 cites W2153099927 @default.
- W2989062779 cites W2229781928 @default.
- W2989062779 cites W2234907509 @default.
- W2989062779 cites W2337957188 @default.
- W2989062779 cites W2346680648 @default.
- W2989062779 cites W2546951667 @default.
- W2989062779 cites W2579968578 @default.
- W2989062779 cites W2624708114 @default.
- W2989062779 cites W2728378947 @default.
- W2989062779 cites W2765097535 @default.
- W2989062779 cites W2767063510 @default.
- W2989062779 cites W2767698222 @default.
- W2989062779 cites W2792887218 @default.
- W2989062779 cites W2822991389 @default.
- W2989062779 cites W2944996382 @default.
- W2989062779 doi "https://doi.org/10.1016/j.jcis.2019.12.022" @default.
- W2989062779 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/31855795" @default.
- W2989062779 hasPublicationYear "2020" @default.
- W2989062779 type Work @default.
- W2989062779 sameAs 2989062779 @default.
- W2989062779 citedByCount "14" @default.
- W2989062779 countsByYear W29890627792020 @default.
- W2989062779 countsByYear W29890627792021 @default.
- W2989062779 countsByYear W29890627792022 @default.
- W2989062779 countsByYear W29890627792023 @default.
- W2989062779 crossrefType "journal-article" @default.
- W2989062779 hasAuthorship W2989062779A5002914756 @default.
- W2989062779 hasAuthorship W2989062779A5018101817 @default.
- W2989062779 hasAuthorship W2989062779A5020642110 @default.
- W2989062779 hasAuthorship W2989062779A5023762311 @default.
- W2989062779 hasAuthorship W2989062779A5028001366 @default.
- W2989062779 hasAuthorship W2989062779A5038803345 @default.
- W2989062779 hasAuthorship W2989062779A5080053429 @default.
- W2989062779 hasAuthorship W2989062779A5082060907 @default.
- W2989062779 hasAuthorship W2989062779A5084638950 @default.
- W2989062779 hasBestOaLocation W29890627792 @default.
- W2989062779 hasConcept C12554922 @default.
- W2989062779 hasConcept C127413603 @default.
- W2989062779 hasConcept C133571119 @default.
- W2989062779 hasConcept C153642686 @default.
- W2989062779 hasConcept C155672457 @default.
- W2989062779 hasConcept C160892712 @default.
- W2989062779 hasConcept C171250308 @default.
- W2989062779 hasConcept C178790620 @default.
- W2989062779 hasConcept C185592680 @default.
- W2989062779 hasConcept C192157962 @default.
- W2989062779 hasConcept C192562407 @default.