FRINK Linked Data Fragments server

Matches in SemOpenAlex for { <https://semopenalex.org/work/W3136600847> ?p ?o ?g. }

• W3136600847 endingPage "6800" @default.
• W3136600847 startingPage "6787" @default.
• W3136600847 abstract "In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a “spiky” external surface, as well as to nonporous silica nanoparticles. For this, we employed a combination of neutron reflectometry, ellipsometry, dynamic light scattering, and ζ-potential measurements for studies of bacteria-mimicking bilayers formed by palmitoyloleoylphosphatidylcholine/palmitoyloleoylphosphatidylglycerol. The results show that nanoparticle topography strongly influences membrane binding and destabilization. We found that virus-like particles are able to destabilize such lipid membranes, whereas the corresponding smooth silica nanoparticles are not. This effect of particle spikes becomes further accentuated after loading of such particles with LL-37. Thus, peptide-loaded virus-like nanoparticles displayed more pronounced membrane disruption than either peptide-loaded smooth nanoparticles or free LL-37. The structural basis of this was clarified by neutron reflectometry, demonstrating that the virus-like nanoparticles induce trans-membrane defects and promote incorporation of LL-37 throughout both bilayer leaflets. The relevance of such effects of particle spikes for bacterial membrane rupture was further demonstrated by confocal microscopy and live/dead assays on Escherichia coli bacteria. Taken together, these findings demonstrate that topography influences the interaction of nanoparticles with bacteria-mimicking lipid bilayers, both in the absence and presence of antimicrobial peptides, as well as with bacteria. The results also identify virus-like mesoporous nanoparticles as being of interest in the design of nanoparticles as delivery systems for antimicrobial peptides." @default.
• W3136600847 created "2021-03-29" @default.
• W3136600847 creator A5009634311 @default.
• W3136600847 creator A5013080220 @default.
• W3136600847 creator A5018101817 @default.
• W3136600847 creator A5023762311 @default.
• W3136600847 creator A5024830371 @default.
• W3136600847 creator A5038803345 @default.
• W3136600847 creator A5040213906 @default.
• W3136600847 creator A5051025501 @default.
• W3136600847 creator A5065047387 @default.
• W3136600847 creator A5082060907 @default.
• W3136600847 date "2021-03-16" @default.
• W3136600847 modified "2023-10-15" @default.
• W3136600847 title "Membrane Interactions of Virus-like Mesoporous Silica Nanoparticles" @default.
• W3136600847 cites W1963692950 @default.
• W3136600847 cites W1964000982 @default.
• W3136600847 cites W1968977012 @default.
• W3136600847 cites W1984082275 @default.
• W3136600847 cites W2013133956 @default.
• W3136600847 cites W2020154280 @default.
• W3136600847 cites W2022233756 @default.
• W3136600847 cites W2026870901 @default.
• W3136600847 cites W2028122134 @default.
• W3136600847 cites W2034010375 @default.
• W3136600847 cites W2039657186 @default.
• W3136600847 cites W2042049715 @default.
• W3136600847 cites W2043721389 @default.
• W3136600847 cites W2048623371 @default.
• W3136600847 cites W2054610215 @default.
• W3136600847 cites W2054754338 @default.
• W3136600847 cites W2054878643 @default.
• W3136600847 cites W2057653477 @default.
• W3136600847 cites W2059169173 @default.
• W3136600847 cites W2075551106 @default.
• W3136600847 cites W2077930487 @default.
• W3136600847 cites W2086529087 @default.
• W3136600847 cites W2089124524 @default.
• W3136600847 cites W2099540110 @default.
• W3136600847 cites W2099694187 @default.
• W3136600847 cites W2114526613 @default.
• W3136600847 cites W2115427608 @default.
• W3136600847 cites W2140115060 @default.
• W3136600847 cites W2146029618 @default.
• W3136600847 cites W2229781928 @default.
• W3136600847 cites W2313457734 @default.
• W3136600847 cites W2337957188 @default.
• W3136600847 cites W2346680648 @default.
• W3136600847 cites W2410800889 @default.
• W3136600847 cites W2549697151 @default.
• W3136600847 cites W2579968578 @default.
• W3136600847 cites W2581095595 @default.
• W3136600847 cites W2728378947 @default.
• W3136600847 cites W2736417543 @default.
• W3136600847 cites W2740519342 @default.
• W3136600847 cites W2741302226 @default.
• W3136600847 cites W2767698222 @default.
• W3136600847 cites W2769940237 @default.
• W3136600847 cites W2786621818 @default.
• W3136600847 cites W2792697682 @default.
• W3136600847 cites W2901561914 @default.
• W3136600847 cites W2944996382 @default.
• W3136600847 cites W2971651667 @default.
• W3136600847 cites W2979843137 @default.
• W3136600847 cites W2981022755 @default.
• W3136600847 cites W2989062779 @default.
• W3136600847 cites W3001892650 @default.
• W3136600847 cites W3007633624 @default.
• W3136600847 cites W3048987220 @default.
• W3136600847 cites W3082680015 @default.
• W3136600847 cites W4239167255 @default.
• W3136600847 cites W4242318543 @default.
• W3136600847 cites W922382438 @default.
• W3136600847 doi "https://doi.org/10.1021/acsnano.0c10378" @default.
• W3136600847 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/33724786" @default.
• W3136600847 hasPublicationYear "2021" @default.
• W3136600847 type Work @default.
• W3136600847 sameAs 3136600847 @default.
• W3136600847 citedByCount "47" @default.
• W3136600847 countsByYear W31366008472021 @default.
• W3136600847 countsByYear W31366008472022 @default.
• W3136600847 countsByYear W31366008472023 @default.
• W3136600847 crossrefType "journal-article" @default.
• W3136600847 hasAuthorship W3136600847A5009634311 @default.
• W3136600847 hasAuthorship W3136600847A5013080220 @default.
• W3136600847 hasAuthorship W3136600847A5018101817 @default.
• W3136600847 hasAuthorship W3136600847A5023762311 @default.
• W3136600847 hasAuthorship W3136600847A5024830371 @default.
• W3136600847 hasAuthorship W3136600847A5038803345 @default.
• W3136600847 hasAuthorship W3136600847A5040213906 @default.
• W3136600847 hasAuthorship W3136600847A5051025501 @default.
• W3136600847 hasAuthorship W3136600847A5065047387 @default.
• W3136600847 hasAuthorship W3136600847A5082060907 @default.
• W3136600847 hasBestOaLocation W31366008471 @default.
• W3136600847 hasConcept C104015590 @default.
• W3136600847 hasConcept C120665830 @default.
• W3136600847 hasConcept C121332964 @default.
• W3136600847 hasConcept C12554922 @default.

• next