Matches in SemOpenAlex for { <https://semopenalex.org/work/W4200503452> ?p ?o ?g. }
Showing items 1 to 63 of
63
with 100 items per page.
- W4200503452 abstract "Infection with the Zika virus results in severe neurological disease in adults or congenital Zika syndrome in newborns. We employed the domain search strategy to study the Zika virus glycoprotein E in this work. The results revealed that immature E contains a NGF domain (“MNKCYIQIMDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHH”) and is capable of interacting with TrkA. The E/TrkA complex increased E's interaction with receptors such as Axl and facilitated Zika virus endocytosis via clathrin. Rab5 retrograded transmission of Zika virus-containing E/TrkA endosomal signals to neuronal soma. Rab7 helped dissociation of E/TrkA in late acidic endosomes, and then E became mature after the NGF domain was cut. After membrane fusion with the endosome, the Zika virus was released into the neuron cell body. It showed only the immature E protein of Zika had NGF activity. The retrograde trafficking of endosomal signals (E/TrkA) similar to NGF/TrkA enabled Zika virus to infect neuronal cells. E's interference with the TrkA signal impaired neuronal cell growth and results in neuronal cell apoptosis." @default.
- W4200503452 created "2021-12-31" @default.
- W4200503452 creator A5038452401 @default.
- W4200503452 creator A5041366828 @default.
- W4200503452 date "2021-12-08" @default.
- W4200503452 modified "2023-09-27" @default.
- W4200503452 title "Zika Virus Enters Soma of Neuron through NGF/TrkA-Like Endosomal Signaling Pathway" @default.
- W4200503452 doi "https://doi.org/10.26434/chemrxiv-2021-2c9mg" @default.
- W4200503452 hasPublicationYear "2021" @default.
- W4200503452 type Work @default.
- W4200503452 citedByCount "0" @default.
- W4200503452 crossrefType "posted-content" @default.
- W4200503452 hasAuthorship W4200503452A5038452401 @default.
- W4200503452 hasAuthorship W4200503452A5041366828 @default.
- W4200503452 hasBestOaLocation W42005034521 @default.
- W4200503452 hasConcept C102747710 @default.
- W4200503452 hasConcept C159047783 @default.
- W4200503452 hasConcept C169760540 @default.
- W4200503452 hasConcept C170493617 @default.
- W4200503452 hasConcept C171034665 @default.
- W4200503452 hasConcept C2522874641 @default.
- W4200503452 hasConcept C2777053367 @default.
- W4200503452 hasConcept C2778423431 @default.
- W4200503452 hasConcept C2778794669 @default.
- W4200503452 hasConcept C2779617337 @default.
- W4200503452 hasConcept C28005876 @default.
- W4200503452 hasConcept C55493867 @default.
- W4200503452 hasConcept C79747257 @default.
- W4200503452 hasConcept C79879829 @default.
- W4200503452 hasConcept C86803240 @default.
- W4200503452 hasConcept C95444343 @default.
- W4200503452 hasConceptScore W4200503452C102747710 @default.
- W4200503452 hasConceptScore W4200503452C159047783 @default.
- W4200503452 hasConceptScore W4200503452C169760540 @default.
- W4200503452 hasConceptScore W4200503452C170493617 @default.
- W4200503452 hasConceptScore W4200503452C171034665 @default.
- W4200503452 hasConceptScore W4200503452C2522874641 @default.
- W4200503452 hasConceptScore W4200503452C2777053367 @default.
- W4200503452 hasConceptScore W4200503452C2778423431 @default.
- W4200503452 hasConceptScore W4200503452C2778794669 @default.
- W4200503452 hasConceptScore W4200503452C2779617337 @default.
- W4200503452 hasConceptScore W4200503452C28005876 @default.
- W4200503452 hasConceptScore W4200503452C55493867 @default.
- W4200503452 hasConceptScore W4200503452C79747257 @default.
- W4200503452 hasConceptScore W4200503452C79879829 @default.
- W4200503452 hasConceptScore W4200503452C86803240 @default.
- W4200503452 hasConceptScore W4200503452C95444343 @default.
- W4200503452 hasLocation W42005034521 @default.
- W4200503452 hasOpenAccess W4200503452 @default.
- W4200503452 hasPrimaryLocation W42005034521 @default.
- W4200503452 hasRelatedWork W131364339 @default.
- W4200503452 hasRelatedWork W1600856176 @default.
- W4200503452 hasRelatedWork W1997958073 @default.
- W4200503452 hasRelatedWork W2128029269 @default.
- W4200503452 hasRelatedWork W2135012473 @default.
- W4200503452 hasRelatedWork W2166193953 @default.
- W4200503452 hasRelatedWork W2765130985 @default.
- W4200503452 hasRelatedWork W2914521507 @default.
- W4200503452 hasRelatedWork W3209732172 @default.
- W4200503452 hasRelatedWork W4200503452 @default.
- W4200503452 isParatext "false" @default.
- W4200503452 isRetracted "false" @default.
- W4200503452 workType "article" @default.