Matches in SemOpenAlex for { <https://semopenalex.org/work/W4377289912> ?p ?o ?g. }
Showing items 1 to 93 of
93
with 100 items per page.
- W4377289912 abstract "Background: Conotoxins exhibit great potential as neuropharmacology tools and therapeutic candidates due to their high affinity and specificity for ion channels, neurotransmitter receptors or transporters. The traditional methods to discover new conotoxins are peptide purification from the crude venom or gene amplification from the venom duct. Methods: In this study, a novel O1 superfamily conotoxin Tx6.7 was directly cloned from the genomic DNA of Conus textile using primers corresponding to the conserved intronic sequence and 3’ UTR elements. The mature peptide of Tx6.7 (DCHERWDWCPASLLGVIYCCEGLICFIAFCI) was synthesized by solid-phase chemical synthesis and confirmed by mass spectrometry. Results: Patch clamp experiments on rat DRG neurons showed that Tx6.7 inhibited peak calcium currents by 59.29 ± 2.34% and peak potassium currents by 22.33 ± 7.81%. In addition, patch clamp on the ion channel subtypes showed that 10 μM Tx6.7 inhibited 56.61 ± 3.20% of the hCaV1.2 currents, 24.67 ± 0.91% of the hCaV2.2 currents and 7.30 ± 3.38% of the hNaV1.8 currents. Tx6.7 had no significant toxicity to ND7/23 cells and increased the pain threshold from 0.5 to 4 hours in the mouse hot plate assay. Conclusion: Our results suggested that direct cloning of conotoxin sequences from the genomic DNA of cone snails would be an alternative approach to obtaining novel conotoxins. Tx6.7 could be used as a probe tool for ion channel research or a therapeutic candidate for novel drug development." @default.
- W4377289912 created "2023-05-23" @default.
- W4377289912 creator A5011070316 @default.
- W4377289912 creator A5017841524 @default.
- W4377289912 creator A5028759593 @default.
- W4377289912 creator A5035683126 @default.
- W4377289912 creator A5082203803 @default.
- W4377289912 creator A5089990345 @default.
- W4377289912 date "2023-01-01" @default.
- W4377289912 modified "2023-09-25" @default.
- W4377289912 title "O1-conotoxin Tx6.7 cloned from the genomic DNA of Conus textile that inhibits calcium currents" @default.
- W4377289912 cites W1851624642 @default.
- W4377289912 cites W1967382991 @default.
- W4377289912 cites W2002109116 @default.
- W4377289912 cites W2038887231 @default.
- W4377289912 cites W2050463685 @default.
- W4377289912 cites W2110196922 @default.
- W4377289912 cites W2130064123 @default.
- W4377289912 cites W2139074038 @default.
- W4377289912 cites W2163545771 @default.
- W4377289912 cites W2411729015 @default.
- W4377289912 cites W2589009438 @default.
- W4377289912 cites W2763735486 @default.
- W4377289912 cites W2766760305 @default.
- W4377289912 cites W2771900358 @default.
- W4377289912 cites W2781788762 @default.
- W4377289912 cites W2916120757 @default.
- W4377289912 cites W2950734847 @default.
- W4377289912 cites W2981905730 @default.
- W4377289912 cites W3025423039 @default.
- W4377289912 cites W3035314630 @default.
- W4377289912 cites W3047061628 @default.
- W4377289912 cites W3120767388 @default.
- W4377289912 cites W3128439475 @default.
- W4377289912 cites W3166757034 @default.
- W4377289912 cites W4318475090 @default.
- W4377289912 doi "https://doi.org/10.1590/1678-9199-jvatitd-2022-0085" @default.
- W4377289912 hasPubMedId "https://pubmed.ncbi.nlm.nih.gov/37283723" @default.
- W4377289912 hasPublicationYear "2023" @default.
- W4377289912 type Work @default.
- W4377289912 citedByCount "0" @default.
- W4377289912 crossrefType "journal-article" @default.
- W4377289912 hasAuthorship W4377289912A5011070316 @default.
- W4377289912 hasAuthorship W4377289912A5017841524 @default.
- W4377289912 hasAuthorship W4377289912A5028759593 @default.
- W4377289912 hasAuthorship W4377289912A5035683126 @default.
- W4377289912 hasAuthorship W4377289912A5082203803 @default.
- W4377289912 hasAuthorship W4377289912A5089990345 @default.
- W4377289912 hasBestOaLocation W43772899121 @default.
- W4377289912 hasConcept C105702510 @default.
- W4377289912 hasConcept C147944092 @default.
- W4377289912 hasConcept C153911025 @default.
- W4377289912 hasConcept C170493617 @default.
- W4377289912 hasConcept C175234850 @default.
- W4377289912 hasConcept C17757408 @default.
- W4377289912 hasConcept C185592680 @default.
- W4377289912 hasConcept C2777734688 @default.
- W4377289912 hasConcept C2779448229 @default.
- W4377289912 hasConcept C50254741 @default.
- W4377289912 hasConcept C552990157 @default.
- W4377289912 hasConcept C55493867 @default.
- W4377289912 hasConcept C86803240 @default.
- W4377289912 hasConceptScore W4377289912C105702510 @default.
- W4377289912 hasConceptScore W4377289912C147944092 @default.
- W4377289912 hasConceptScore W4377289912C153911025 @default.
- W4377289912 hasConceptScore W4377289912C170493617 @default.
- W4377289912 hasConceptScore W4377289912C175234850 @default.
- W4377289912 hasConceptScore W4377289912C17757408 @default.
- W4377289912 hasConceptScore W4377289912C185592680 @default.
- W4377289912 hasConceptScore W4377289912C2777734688 @default.
- W4377289912 hasConceptScore W4377289912C2779448229 @default.
- W4377289912 hasConceptScore W4377289912C50254741 @default.
- W4377289912 hasConceptScore W4377289912C552990157 @default.
- W4377289912 hasConceptScore W4377289912C55493867 @default.
- W4377289912 hasConceptScore W4377289912C86803240 @default.
- W4377289912 hasLocation W43772899121 @default.
- W4377289912 hasLocation W43772899122 @default.
- W4377289912 hasOpenAccess W4377289912 @default.
- W4377289912 hasPrimaryLocation W43772899121 @default.
- W4377289912 hasRelatedWork W2023259110 @default.
- W4377289912 hasRelatedWork W2040301159 @default.
- W4377289912 hasRelatedWork W2134571618 @default.
- W4377289912 hasRelatedWork W2160386479 @default.
- W4377289912 hasRelatedWork W2244471296 @default.
- W4377289912 hasRelatedWork W2359427500 @default.
- W4377289912 hasRelatedWork W2739114548 @default.
- W4377289912 hasRelatedWork W3125876910 @default.
- W4377289912 hasRelatedWork W4377289912 @default.
- W4377289912 hasRelatedWork W67604280 @default.
- W4377289912 hasVolume "29" @default.
- W4377289912 isParatext "false" @default.
- W4377289912 isRetracted "false" @default.
- W4377289912 workType "article" @default.